KEGG   Pongo abelii (Sumatran orangutan): 100434256
Entry
100434256         CDS       T01416                                 

Gene name
CDC25B
Definition
(RefSeq) M-phase inducer phosphatase 2 isoform X1
  KO
K05866  M-phase inducer phosphatase 2 [EC:3.1.3.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04110  Cell cycle
pon04914  Progesterone-mediated oocyte maturation
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100434256 (CDC25B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100434256 (CDC25B)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100434256 (CDC25B)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100434256 (CDC25B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100434256 (CDC25B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100434256 (CDC25B)
   03400 DNA repair and recombination proteins [BR:pon03400]
    100434256 (CDC25B)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100434256 (CDC25B)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    100434256 (CDC25B)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Centriole replication proteins
     100434256 (CDC25B)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100434256 (CDC25B)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 100434256
NCBI-ProteinID: XP_009231674
Ensembl: ENSPPYG00000010811
LinkDB
Position
20
AA seq 601 aa
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSHSRLTRLSLSRRASESSLSSESSEYSDAGLCMDSPSPMDPQMAEQTFEQAIQA
ASRVIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKNEAGSGAASSSGEDKEN
VRFWKAGVGALRGEEGACWSGSLACEDLPLPSWLQDGFVFKMPWKPTHPSSTHALAEWAS
RREAFAQRPSSAPDLMCLSPERKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDL
KDDDAVPPGMESLISAPLVKTLEKEDEQDLVMYSKCQRLFRSPSMPCSVIRPILKRLERP
QDRDTPVQNKRRRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKA
FLLQTVDGKHQDLKYISPETMVALLMGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPL
ERDAESFLLQSPITPCSLDKRVILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEM
YILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQD
Q
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggaggtgccccagccggagcccgcgccaggctcggctctcagtccagcaggcgtgtgc
ggtggcgcccagcgtccgggccacctcccgggcctcctgctgggatctcatggcctcctg
gggtccccggtgcgcgcggccgcttcctcgccggtcaccaccctcacccagaccatgcac
gacctcgccgggctcggcagccacagccgcctgacgcgcctatccctgtctcgacgggca
tctgaatcctccctgtcgtctgaatcctccgaatattctgatgcaggtctctgcatggat
tcccccagtcctatggatccccagatggcagagcagacgtttgaacaggccatccaggca
gccagccgggtcattcgaaacgagcagtttgccatcagacgcttccagtctatgccggtg
aggctgctgggccacagccccgtgcttcggaacatcaccaactcccaggcgcccgacggc
cggaggaagaacgaggcgggcagtggagctgccagcagctctggggaagacaaggagaat
gtgcgcttctggaaggcaggagtgggagctctccggggagaggagggggcatgctggagt
ggttccctggcatgtgaggaccttcctctcccatcttggctgcaggatggatttgtcttc
aagatgccatggaagcccacacatcccagctccacccatgctctggcagagtgggccagc
cgcagggaagcctttgcccagagacccagctcggcccccgacctgatgtgtctcagtcct
gagcggaagatggaagtggaggagctcagccccctggccctaggtcgcttctctctgacc
cctgcagagggggatactgaggaagatgatggatttgtggacatcctagagagtgactta
aaggacgatgatgcagttcccccaggcatggagagtctcattagtgccccactggtcaag
actttggaaaaggaagatgaacaggacctcgtcatgtacagcaagtgccagcggctcttc
cgctctccatccatgccctgcagcgtgatccggcccatcctcaagaggctggagcggccc
caggacagggacacacccgtgcagaataagcggaggcggagcgtgacccctcctgaggag
cagcaggaggctgaggaacctaaagcccgcgtcctccgctccaaatcactgtgtcacgat
gagatcgagaacctcctggacagtgaccaccgagagctgattggagattactctaaggcc
ttcctcctacagacagtagatggaaagcaccaagacctcaagtacatctcaccagaaacg
atggtggccctgttgatgggcaagttcagcaacatcgtggataagtttgtgattgtagac
tgcagatacccctatgagtatgaaggcgggcacatcaagactgcggtgaacttgcccctg
gaacgcgacgccgagagcttcctgctgcagagccccatcacaccctgtagcctggacaag
agagtcattctcattttccactgtgaattctcatctgagcgtgggccccgcatgtgccgt
ttcatcagggaacgagaccgtgctgtcaacgactaccccagcctctactaccccgagatg
tatatcctgaaaggcggctacaaggagttcttccctcagcacccgaacttctgtgaaccc
caggactaccggcccatgaaccacgaggccttcaaggatgagctaaagaccttccgcctc
aagactcgcagctgggctggggagcggagccggcgggagctctgtagccggctgcaggac
cagtga

KEGG   Pongo abelii (Sumatran orangutan): 100451443
Entry
100451443         CDS       T01416                                 

Gene name
CDC25C
Definition
(RefSeq) M-phase inducer phosphatase 3 isoform X1
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04914  Progesterone-mediated oocyte maturation
pon05170  Human immunodeficiency virus 1 infection
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100451443 (CDC25C)
   04114 Oocyte meiosis
    100451443 (CDC25C)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100451443 (CDC25C)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100451443 (CDC25C)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100451443 (CDC25C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100451443 (CDC25C)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100451443 (CDC25C)
   03400 DNA repair and recombination proteins [BR:pon03400]
    100451443 (CDC25C)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100451443 (CDC25C)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100451443 (CDC25C)
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    100451443 (CDC25C)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100451443 (CDC25C)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100451443 (CDC25C)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 100451443
NCBI-ProteinID: XP_009239369
Ensembl: ENSPPYG00000015825
UniProt: A0A2J8VPV2
LinkDB
Position
5
AA seq 506 aa
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSVEITATQLTISADLDETGHLDSSGLQEVHLAGMNHHQHLMK
CSPAQLLCSTPNGLDCGHRKRDAMCSSSANKENENSTLKPLEWQAPRNLRFQKRPGKPYV
SPLSLLDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLEDQEAKVS
RSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLRLKKTVSLCDI
NITQMLEEDSNHGHLIGDFSKVCALPTVSGKHQDLKYVDPETVAALLSGKFQGLIEKFYV
IDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIIPLDTQKRIIIVFHCEFSSERGPRM
CRSLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHQTELLRC
RSQSKVQEGERQLREQIALLVKDVSP
NT seq 1521 nt   +upstreamnt  +downstreamnt
atgtctacggaactcttctcatccacaagagaggaaggaagctctggctcaggacccagt
tttaggtctaatcaaaggaaaatgttaaacctgctcctggagagagacacttcctttact
gtctgtccagatgtccctagaactccagtgggcaaatttcttggtgattctgcaaaccta
agcattttgtctggaggaaccccaaaacgttgcctcgatctttcgaatcttagcagtgtg
gagataactgccactcagcttaccatttctgcagaccttgatgaaactggtcacctggat
tcttcaggacttcaggaagtgcatttagctgggatgaatcatcaccagcacctaatgaaa
tgtagcccagcacagcttctttgtagcactccgaatggtttggactgtggccatagaaag
agagatgcaatgtgtagttcatctgcaaataaagaaaatgaaaacagcactttgaagccc
ttggagtggcaggcacccaggaatctgaggtttcaaaagagaccaggaaagccttatgtg
tctcctctttctctgctggacaatggaaacttggtggacagtgaaatgaaatatctgggc
agtcctattactactgttccaaaattggataaaaatccaaacctaggagaagaccaggca
gaagagatttcagatgaattaatggagttttccctggaagatcaagaagcaaaggtgagc
agaagcggcctatatcgctccccctcgatgccagagaacttgaacaggccaagactgaag
caggtggaaaaattcaaggacaacacaataccagataaagttaaaaaaaagtatttttct
ggccaaggaaagctcaggaagggcttacgtttaaagaagacagtctctctgtgtgacatt
aatatcactcagatgctggaggaagattctaaccatgggcacctgattggtgatttttcc
aaggtatgtgcgctgccaaccgtgtcagggaaacaccaagatctgaagtatgtcgaccca
gaaacagtggctgccttactgtcggggaagttccagggtctgattgagaagttttatgtc
attgattgtcgctatccatatgagtacctgggaggacacatccagggagccttaaacttg
tatagtcaggaagaactgtttaacttctttctgaagaagcccattatccctttggacacc
cagaagagaataatcatcgtgttccactgtgaattctcctcagagaggggcccccgaatg
tgccgctctctgcgtgaagaggacaggtctctgaaccagtatcctgcattgtactaccca
gagctatatatccttaaaggcggctacagagacttctttccagaatatatggagctgtgt
gaaccacagagctactgccccatgcatcatcaggaccaccagactgagttgctgaggtgt
cgaagccagagcaaagtgcaggaaggggagcggcagctgcgggagcaaattgcccttctg
gtgaaggacgtgagcccatga

KEGG   Pongo abelii (Sumatran orangutan): 100460228
Entry
100460228         CDS       T01416                                 

Gene name
CDC25A
Definition
(RefSeq) M-phase inducer phosphatase 1 isoform X3
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04218  Cellular senescence
pon04914  Progesterone-mediated oocyte maturation
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100460228 (CDC25A)
   04218 Cellular senescence
    100460228 (CDC25A)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100460228 (CDC25A)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100460228 (CDC25A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100460228 (CDC25A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100460228 (CDC25A)
   03400 DNA repair and recombination proteins [BR:pon03400]
    100460228 (CDC25A)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100460228 (CDC25A)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    100460228 (CDC25A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100460228 (CDC25A)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100460228 (CDC25A)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 100460228
NCBI-ProteinID: XP_002813847
Ensembl: ENSPPYG00000013912
UniProt: A0A2J8TFU5
LinkDB
Position
3
AA seq 484 aa
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYA
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLSQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVD
LLDGENLKNEEETPSCMASLWTAPLVMRTANLDNRSKLFDSPSLCSSSTRSVLKRPERSQ
EESPPGNTKRRKSMSGASPKESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGD
FSKGYLFHTVAGKHQDLKYISPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAV
NLHMEEEVEDFLLKKPIVPTDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHY
PELYVLKGGYKEFFMKCQSYCEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSR
LKKL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggaactgggcccggagcccccgcaccgccgccgcctgctcttcgcctgcagcccccct
cccgcgtcgcagcccgtcgtgaaggcgctatttggcgcttcagccgccgggggactgtcg
cctgtcaccaacctgaccgtcactatggaccagctgcaggggctgggcagtgattatgcg
caaccactggaggtgaagaacaacagtaatctgcagagaatgggctcctccgagtcaaca
gattcaggtttctgtctagattctcctgggccattggacagtaaagaaaaccttgaaaat
cccatgagaagaatacattccctatctcagaagctgttgggatgtagtccagctctgaag
aggagccattctgattctcttgaccatgacatctttcagctcatcgacccagatgagaac
aaggaaaatctttcctcaaatgaaagagatagcagtgaaccagggaatttcattcctctt
tttacaccccagtcacctgtgacagccactttgtctgatgaggatgatggcttcgtggac
cttctcgatggagagaatctgaagaatgaggaggagaccccctcgtgcatggcaagcctc
tggacagctcctctcgtcatgagaactgcaaaccttgacaatcgaagcaagctgtttgac
tccccttccctgtgtagctccagcactcggtcagtgttgaagagaccagaacgatctcaa
gaggagtctccacctggaaatacaaagaggaggaagagcatgtctggggccagccccaaa
gagtcaactaatccagagaaggcccatgagactcttcatcagtctttatccctggcatct
tcccccaaaggaaccattgagaacattttggacaatgacccaagggaccttataggagac
ttctccaagggttatctctttcatacagttgctgggaaacatcaggatttaaaatacatc
tctccagaaattatggcatctgttttgaatggcaagtttgccaacctcattaaagagttt
gttatcattgactgtcgatacccatatgaatacgagggaggccacatcaagggtgcagtg
aacttgcacatggaagaagaggttgaagacttcttactgaagaagcccattgtacctact
gatggcaagcgtgtcattgttgtgtttcactgcgagttttcttctgagagaggtccccgc
atgtgccggtatgtgagagagagagatcgcctgggtaatgaataccccaaactccactac
cctgagctgtatgtcctgaaggggggatacaaggagttctttatgaaatgccagtcttac
tgtgagccccctagctaccggcccatgcaccacgaggactttaaagaagacctgaagaag
ttccgcaccaagagccggacctgggcaggggagaagagcaagagggagatgtacagtcgt
ctgaagaagctctga

DBGET integrated database retrieval system