KEGG   Panthera tigris altaica (Amur tiger): 102949955
Entry
102949955         CDS       T02988                                 

Gene name
GPX4
Definition
(RefSeq) glutathione peroxidase 4
  KO
K05361  phospholipid-hydroperoxide glutathione peroxidase [EC:1.11.1.12]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102949955 (GPX4)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    102949955 (GPX4)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.12  phospholipid-hydroperoxide glutathione peroxidase
     102949955 (GPX4)
SSDB
Motif
Pfam: GSHPx AhpC-TSA
Other DBs
NCBI-GeneID: 102949955
NCBI-ProteinID: XP_007099407
LinkDB
Position
Un
AA seq 157 aa
MHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAF
PCNQFGRQEPGSNAEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKVQPKGRGILGNA
IKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPCYL
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcacgagttctcagccaaggacatcgatggacacatggttaatctggacaagtaccgg
ggcttcgtgtgcatagtcaccaacgtggcctcgcaatgaggcaaaacggaggtaaactat
actcagcttgtcgacctgcacgccagatacgctgagtgtggtttacggatcctggccttc
ccttgcaaccagttcgggaggcaggaaccagggagtaacgcggagatcaaggagttcgct
gctggctataatgtcaagttcgatatgttcagcaagatctgtgtgaacggggatgatgcc
cacccgctgtggaagtggatgaaagtccagcccaaggggaggggcatcttggggaatgcc
atcaaatggaacttcaccaagttcctcattgacaagaatggctgcgtggtgaagcggtac
ggtcccatggaagagcccctggtgatcgagaaggacttgccctgctacctctag

DBGET integrated database retrieval system