KEGG   Pan troglodytes (chimpanzee): 449565
Entry
449565            CDS       T01005                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform 1 precursor
  KO
K05430  interleukin 4
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04151  PI3K-Akt signaling pathway
ptr04630  JAK-STAT signaling pathway
ptr04640  Hematopoietic cell lineage
ptr04657  IL-17 signaling pathway
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04672  Intestinal immune network for IgA production
ptr05140  Leishmaniasis
ptr05200  Pathways in cancer
ptr05310  Asthma
ptr05320  Autoimmune thyroid disease
ptr05321  Inflammatory bowel disease
ptr05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    449565 (IL4)
   04151 PI3K-Akt signaling pathway
    449565 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    449565 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    449565 (IL4)
   04660 T cell receptor signaling pathway
    449565 (IL4)
   04658 Th1 and Th2 cell differentiation
    449565 (IL4)
   04659 Th17 cell differentiation
    449565 (IL4)
   04657 IL-17 signaling pathway
    449565 (IL4)
   04664 Fc epsilon RI signaling pathway
    449565 (IL4)
   04672 Intestinal immune network for IgA production
    449565 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    449565 (IL4)
  09163 Immune disease
   05310 Asthma
    449565 (IL4)
   05320 Autoimmune thyroid disease
    449565 (IL4)
   05321 Inflammatory bowel disease
    449565 (IL4)
   05330 Allograft rejection
    449565 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    449565 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptr04052]
    449565 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:ptr00536]
    449565 (IL4)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Interleukins
   449565 (IL4)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Haparin
  Cytokines
   449565 (IL4)
SSDB
Motif
Pfam: IL4 Mannosyl_trans3
Other DBs
NCBI-GeneID: 449565
NCBI-ProteinID: NP_001011714
Ensembl: ENSPTRG00000017220
VGNC: 4046
UniProt: Q8HYB1
LinkDB
Position
5
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFVHGHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKETNQSTLENFLERLKTIMREKYSKCSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgtccacggacacaagtgcgatatcaccttacaggagatcatcaaaactttgaacagc
ctcacagagcagaagactctgtgcaccgagttgaccgtaacagacatctttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgcctgggtgcgactgcacagcagttccacaggcac
aagcagctgatccgattcctgaaacggctcgacaggaacctctggggcctggcgggcttg
aattcctgtcctgtgaaggaaaccaaccagagtacgttggaaaacttcttggaaaggcta
aagacgatcatgagagagaaatattcaaagtgttcgagctga

DBGET integrated database retrieval system