KEGG   Pan troglodytes (chimpanzee): 453054
Entry
453054            CDS       T01005                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3 isoform X1
  KO
K13377  transforming growth factor beta-3
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04218  Cellular senescence
ptr04350  TGF-beta signaling pathway
ptr04390  Hippo signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05144  Malaria
ptr05145  Toxoplasmosis
ptr05146  Amoebiasis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05220  Chronic myeloid leukemia
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05321  Inflammatory bowel disease
ptr05323  Rheumatoid arthritis
ptr05410  Hypertrophic cardiomyopathy
ptr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    453054 (TGFB3)
   04350 TGF-beta signaling pathway
    453054 (TGFB3)
   04390 Hippo signaling pathway
    453054 (TGFB3)
   04068 FoxO signaling pathway
    453054 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    453054 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    453054 (TGFB3)
   04218 Cellular senescence
    453054 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    453054 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    453054 (TGFB3)
   05212 Pancreatic cancer
    453054 (TGFB3)
   05225 Hepatocellular carcinoma
    453054 (TGFB3)
   05226 Gastric cancer
    453054 (TGFB3)
   05220 Chronic myeloid leukemia
    453054 (TGFB3)
   05211 Renal cell carcinoma
    453054 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    453054 (TGFB3)
   05321 Inflammatory bowel disease
    453054 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    453054 (TGFB3)
   05414 Dilated cardiomyopathy
    453054 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    453054 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    453054 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    453054 (TGFB3)
   05161 Hepatitis B
    453054 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    453054 (TGFB3)
   05144 Malaria
    453054 (TGFB3)
   05145 Toxoplasmosis
    453054 (TGFB3)
   05140 Leishmaniasis
    453054 (TGFB3)
   05142 Chagas disease
    453054 (TGFB3)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   453054 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 453054
NCBI-ProteinID: XP_001161669
Ensembl: ENSPTRG00000006562
VGNC: 3304
UniProt: H2Q8N5 A0A6D2Y2I1
LinkDB
Position
14
AA seq 412 aa
MKMHLQRALVVLALLNFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPT
VMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNEL
AVCPKGITSKVFRFNVSSVEKNRTNLFRAEFRVLRVPNPSSKRNEQRIELFQILRPDEHI
AKQRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILE
NIHEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHST
VLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaagatgcacttgcaaagggctctggtggtcctggccctgctgaactttgccacggtc
agcctctctctgtccacttgcaccaccttggacttcggccacatcaagaagaagagggtg
gaagccattaggggacagatcttgagcaagctcaggctcaccagcccccctgagccaacg
gtgatgacccacgtcccctatcaggtcctggccctttacaacagcacccgggagctgctg
gaggagatgcatggggagagggaggaaggctgcacccaggaaaacaccgagtcggaatac
tatgccaaagaaatccataaattcgacatgatccaggggctggcggagcacaacgaactg
gctgtctgccctaaaggaattacctccaaggttttccgcttcaatgtgtcctcagtggag
aaaaatagaaccaacctattccgagcagaattccgggtcttgcgggtgcccaaccccagc
tctaagcggaatgagcagaggatcgagctcttccagatccttcggccagatgagcacatt
gccaaacagcgctatatcggtggcaagaatctgcccacacggggcactgccgagtggctg
tcctttgatgtcactgacactgtgcgtgagtggctgttgagaagagagtccaacttaggt
ctagaaatcagcattcactgtccatgtcacacctttcagcccaatggagatatcctggaa
aacattcacgaggtgatggaaatcaaattcaaaggcgtggacaatgaggatgaccatggc
cgtggagatctggggcgcctcaagaagcagaaggatcaccacaaccctcatctaatcctc
atgatgattcccccacaccggctcgacaacccgggccaggggggtcagaggaagaagcgg
gccttggacaccaattactgcttccgcaacttggaggagaactgctgtgtgcgccccctc
tacattgacttccgacaggatctgggctggaagtgggtccatgaacctaagggctactat
gccaacttctgctcaggcccttgcccatacctccgcagtgcagacacaacccacagcacg
gtgctgggactgtacaacactctgaaccctgaagcatctgcctcgccttgctgcgtgccc
caggacctggagcccctgaccatcctgtactatgttgggaggacccccaaagtggagcag
ctctctaacatggtggtgaagtcttgtaaatgtagctga

KEGG   Pan troglodytes (chimpanzee): 456060
Entry
456060            CDS       T01005                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 isoform X2
  KO
K13375  transforming growth factor beta-1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04218  Cellular senescence
ptr04350  TGF-beta signaling pathway
ptr04380  Osteoclast differentiation
ptr04390  Hippo signaling pathway
ptr04659  Th17 cell differentiation
ptr04672  Intestinal immune network for IgA production
ptr04926  Relaxin signaling pathway
ptr04932  Non-alcoholic fatty liver disease
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05144  Malaria
ptr05145  Toxoplasmosis
ptr05146  Amoebiasis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05220  Chronic myeloid leukemia
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05321  Inflammatory bowel disease
ptr05323  Rheumatoid arthritis
ptr05410  Hypertrophic cardiomyopathy
ptr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    456060 (TGFB1)
   04350 TGF-beta signaling pathway
    456060 (TGFB1)
   04390 Hippo signaling pathway
    456060 (TGFB1)
   04068 FoxO signaling pathway
    456060 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    456060 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    456060 (TGFB1)
   04218 Cellular senescence
    456060 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    456060 (TGFB1)
   04672 Intestinal immune network for IgA production
    456060 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    456060 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    456060 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    456060 (TGFB1)
   05205 Proteoglycans in cancer
    456060 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    456060 (TGFB1)
   05212 Pancreatic cancer
    456060 (TGFB1)
   05225 Hepatocellular carcinoma
    456060 (TGFB1)
   05226 Gastric cancer
    456060 (TGFB1)
   05220 Chronic myeloid leukemia
    456060 (TGFB1)
   05211 Renal cell carcinoma
    456060 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    456060 (TGFB1)
   05321 Inflammatory bowel disease
    456060 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    456060 (TGFB1)
   05414 Dilated cardiomyopathy
    456060 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    456060 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    456060 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    456060 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    456060 (TGFB1)
   05161 Hepatitis B
    456060 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    456060 (TGFB1)
   05144 Malaria
    456060 (TGFB1)
   05145 Toxoplasmosis
    456060 (TGFB1)
   05140 Leishmaniasis
    456060 (TGFB1)
   05142 Chagas disease
    456060 (TGFB1)
Chaperones and folding catalysts [BR:ptr03110]
 Intramolecular chaperones
  Others
   456060 (TGFB1)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   456060 (TGFB1)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   456060 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 456060
NCBI-ProteinID: XP_009433930
Ensembl: ENSPTRG00000011021
VGNC: 2232
LinkDB
Position
19
AA seq 391 aa
MPPSGLRLLPLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI
YDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINAGF
TTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctaccgctgctgtggctactggtg
ctgacgcctggccggccggccgcgggactatccacctgcaagactatcgacatggagctg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtggccggggagagtgcagaaccggagcccgagcctgag
gccgactactacgccaaggaggtcacccgcgtgctaatggtggaaacccacaacgaaatc
tatgacaagttcaagcagagtacacacagcatatatatgttcttcaacacatcagagctc
cgagaagcggtacctgaacccgtgttgctctcccgggcagagctgcgtctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaacaattcctggcga
tacctcagcaaccggctgctggcacccagcgactcgccagagtggttatcttttgatgtc
accggagttgtgcggcagtggttgagccgcggaggggaaattgagggctttcgccttagc
gcccactgctcctgtgacagcagggataacacactgcaagtggacatcaacgcagggttc
actaccggccgccgaggtgacctggccaccattcacggcatgaaccggcctttcctgctt
ctcatggccaccccgctggagagggcccagcatctgcaaagctcccggcaccgccgagcc
ctggacaccaactattgcttcagctccacggagaagaactgctgcgtgcggcagctgtac
attgacttccgcaaggacctcggctggaagtggatccacgagcccaagggctaccatgcc
aacttctgcctcgggccctgcccctacatttggagcctggacacgcagtacagcaaggtc
ctggccctgtacaaccagcataacccgggcgcctcggcggcgccgtgctgcgtgccgcag
gcgctggagccgctgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tccaacatgatcgtgcgctcctgcaagtgcagctga

KEGG   Pan troglodytes (chimpanzee): 457742
Entry
457742            CDS       T01005                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04060  Cytokine-cytokine receptor interaction
ptr04068  FoxO signaling pathway
ptr04110  Cell cycle
ptr04218  Cellular senescence
ptr04350  TGF-beta signaling pathway
ptr04380  Osteoclast differentiation
ptr04390  Hippo signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr05140  Leishmaniasis
ptr05142  Chagas disease
ptr05144  Malaria
ptr05145  Toxoplasmosis
ptr05146  Amoebiasis
ptr05152  Tuberculosis
ptr05161  Hepatitis B
ptr05166  Human T-cell leukemia virus 1 infection
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05210  Colorectal cancer
ptr05211  Renal cell carcinoma
ptr05212  Pancreatic cancer
ptr05220  Chronic myeloid leukemia
ptr05225  Hepatocellular carcinoma
ptr05226  Gastric cancer
ptr05321  Inflammatory bowel disease
ptr05323  Rheumatoid arthritis
ptr05410  Hypertrophic cardiomyopathy
ptr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    457742 (TGFB2)
   04350 TGF-beta signaling pathway
    457742 (TGFB2)
   04390 Hippo signaling pathway
    457742 (TGFB2)
   04068 FoxO signaling pathway
    457742 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    457742 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    457742 (TGFB2)
   04218 Cellular senescence
    457742 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    457742 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    457742 (TGFB2)
   05206 MicroRNAs in cancer
    457742 (TGFB2)
   05205 Proteoglycans in cancer
    457742 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    457742 (TGFB2)
   05212 Pancreatic cancer
    457742 (TGFB2)
   05225 Hepatocellular carcinoma
    457742 (TGFB2)
   05226 Gastric cancer
    457742 (TGFB2)
   05220 Chronic myeloid leukemia
    457742 (TGFB2)
   05211 Renal cell carcinoma
    457742 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    457742 (TGFB2)
   05321 Inflammatory bowel disease
    457742 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    457742 (TGFB2)
   05414 Dilated cardiomyopathy
    457742 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    457742 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    457742 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    457742 (TGFB2)
   05161 Hepatitis B
    457742 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    457742 (TGFB2)
   05144 Malaria
    457742 (TGFB2)
   05145 Toxoplasmosis
    457742 (TGFB2)
   05140 Leishmaniasis
    457742 (TGFB2)
   05142 Chagas disease
    457742 (TGFB2)
Cytokines and growth factors [BR:ptr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   457742 (TGFB2)
Glycosaminoglycan binding proteins [BR:ptr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   457742 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 457742
NCBI-ProteinID: XP_001172158
Ensembl: ENSPTRG00000001992
VGNC: 7006
UniProt: A0A6D2XJ25 H2Q153
LinkDB
Position
1
AA seq 442 aa
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSLCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQTNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacactcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagtcccccagaagactatcctgagccc
gaggaagtccccccggaggtgatttccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaagagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgttcgattt
gacgtctcagcaatggagaagaatgcttccaatttggtgaaagcagagttcagagtcttt
cgtttgcagaacccaaaagccagagtgcctgaacaacggattgagctctatcagattctc
aagtccaaagatttaacatctccaacccagcgctacatcgacagcaaagttgtgaaaaca
agagcagaaggcgaatggctctccttcgatgtaactgatgctgttcatgaatggcttcac
cataaagacaggaacctgggatttaaaataagcttacactgtccctgctgcacttttgta
ccatctaataattacatcatcccaaataaaagtgaagaactagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttattgccctcctacagacttgag
tcacaacagaccaaccggcggaagaagcgtgctttggatgcagcctattgctttagaaat
gtgcaggataattgctgcctacgtccactttacattgatttcaagagggatctagggtgg
aaatggatacacgaacccaaagggtacaatgccaacttctgtgctggagcatgcccgtat
ttatggagttcagacactcagcacagcagggtcctgagcttatataataccataaatcca
gaagcatctgcttctccttgctgcgtgtcccaagatttagaacctctaaccattctctac
tacattggcaaaacacccaagattgaacagctttctaatatgattgtaaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system