KEGG   Pan troglodytes (chimpanzee): 454268
Entry
454268            CDS       T01005                                 

Gene name
PLCG2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 isoform X1
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04020  Calcium signaling pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04072  Phospholipase D signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04380  Osteoclast differentiation
ptr04611  Platelet activation
ptr04613  Neutrophil extracellular trap formation
ptr04625  C-type lectin receptor signaling pathway
ptr04650  Natural killer cell mediated cytotoxicity
ptr04662  B cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04919  Thyroid hormone signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05169  Epstein-Barr virus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05214  Glioma
ptr05223  Non-small cell lung cancer
ptr05225  Hepatocellular carcinoma
Module
ptr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    454268 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    454268 (PLCG2)
   04014 Ras signaling pathway
    454268 (PLCG2)
   04370 VEGF signaling pathway
    454268 (PLCG2)
   04064 NF-kappa B signaling pathway
    454268 (PLCG2)
   04066 HIF-1 signaling pathway
    454268 (PLCG2)
   04020 Calcium signaling pathway
    454268 (PLCG2)
   04070 Phosphatidylinositol signaling system
    454268 (PLCG2)
   04072 Phospholipase D signaling pathway
    454268 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    454268 (PLCG2)
   04613  Neutrophil extracellular trap formation
    454268 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    454268 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    454268 (PLCG2)
   04662 B cell receptor signaling pathway
    454268 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    454268 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    454268 (PLCG2)
   04670 Leukocyte transendothelial migration
    454268 (PLCG2)
   04062 Chemokine signaling pathway
    454268 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    454268 (PLCG2)
   04919 Thyroid hormone signaling pathway
    454268 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    454268 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    454268 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    454268 (PLCG2)
   04380 Osteoclast differentiation
    454268 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    454268 (PLCG2)
   05206 MicroRNAs in cancer
    454268 (PLCG2)
   05205 Proteoglycans in cancer
    454268 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    454268 (PLCG2)
   05214 Glioma
    454268 (PLCG2)
   05223 Non-small cell lung cancer
    454268 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    454268 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    454268 (PLCG2)
   05171 Coronavirus disease - COVID-19
    454268 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    454268 (PLCG2)
   05169 Epstein-Barr virus infection
    454268 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    454268 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    454268 (PLCG2)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     454268 (PLCG2)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    454268 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    454268 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_12 PH_14 EF-hand_like GDPD
Other DBs
NCBI-GeneID: 454268
NCBI-ProteinID: XP_001148089
Ensembl: ENSPTRG00000008395
VGNC: 8991
UniProt: A0A2I3SHP7
LinkDB
Position
16
AA seq 1265 aa
MSTTVNVDSLAEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEDCCFTILYGTQFVLSTLSLAADSKEDAV
NWLSGLKILHQEAMNASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLINFKVSSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VYLHDFQRFLIHEQQEHWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDAVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSPEAYIRCLRMGCRCIELDC
WDGPDGKPVIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMAKA
FKEVFGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTMEEEVPQDIPPTELHFGEKWFHKKVEKR
TSAEKLLQEYCMETGGKDGTFLVRESETFPNDYTLSFWRSGRVQHCRIRSTMEGGTLKYY
LTDNLTFSSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDML
MRIPRDGAFLIRKREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVSYY
EKHSLYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSEINPSMPQRTVKALYDY
KAKRSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTADFEELEKQII
EDNPLGSLCRGILDLNTYNVVKAPQGKNQKSFVFILEPKKQGDPPVEFATDRVEELFEWF
QSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSFVE
TKADSIIRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTPDKY
MQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLTVKVLGARHLPKLGRSI
ACPFVEVEICGAEYDNNKFKTTVVNDNGLSPIWAPTQEKVTFEIYDPNLAFLRFVVYEED
MFSDPNFLAHATYPIKAIKSGFRSIPLKNGYSEDIELASLLVFCEMRPVLESEEELYSSC
RQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFSVNENQLQLYQEKCNKRLREKRVSN
SKFYS
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgtccaccacggtcaatgtagattcccttgcggaatatgagaagagccagatcaagaga
gccctggagctggggacggtgatgactgtgttcagcttccgcaagtccacccccgagcgg
agaaccgtccaggtgatcatggagacgcggcaggtggcctggagcaagaccgctgacaag
atcgagggcttcttggatatcatggaaataaaagaaatccgcccagggaagaactccaaa
gatttcgagcgagcaaaagcagttcgccagaaagaagactgctgcttcaccatcctgtat
ggcactcagttcgtcctcagcacgctcagcttggcggctgactctaaagaggatgcagtt
aactggctctctggcttgaaaatcttacaccaggaagcgatgaatgcgtccacgcccacc
attatcgagagttggctgagaaagcagatatattctgtggatcaaaccagaagaaacagc
atcagtctccgagagttgaagaccatcttgcccctgatcaactttaaagtgagcagtgcc
aagttccttaaagataagtttgtggaaataggagcacacaaagatgagctcagctttgaa
cagttccatctcttctataaaaaacttatgtttgaacagcaaaaatcgattctcgatgaa
ttcaaaaaggattcgtccgtgttcatcctggggaacactgacaggccggatgcctctgct
gtttacctgcatgacttccagaggtttctcatacatgaacagcaggagcattgggctcag
gatctgaacaaagtccgtgagcggatgacaaagttcattgatgacaccatgcgtgaaact
gctgagcctttcttgtttgtggatgagttcctcacgtacctgttttcacgagaaaacagc
atctgggatgagaagtatgacgcggtggacatgcaggacatgaacaaccccctgtctcat
tactggatctcctcgtcacataacacgtaccttacaggtgaccagctgcggagcgagtcg
tccccagaagcttacatccgctgcctgcgcatgggctgtcgctgcattgaactggactgc
tgggacgggcccgatgggaagccggtcatctaccatggctggacgcggactaccaagatc
aagtttgacgacgtcgtgcaggccatcaaagaccacgcctttgttacctcgagcttccca
gtgatcctgtccatcgaggagcactgcagcgtggagcaacagcgtcacatggccaaggcc
ttcaaggaagtgtttggcgacctgctgctgacgaagcccacggaggccagtgctgaccag
ctgccctcgcccagccagctgcgggagaagatcatcatcaagcataagaagctgggcccc
cgaggcgatgtggatgtcaacatggaggacaagaaggatgagcacaagcaacagggagag
ctgtacatgtgggattccattgaccagaaatggactcggcactactgcgccatcgccgat
gccaagctgtccttcagtgatgacattgaacagactatggaggaggaagtgccccaggat
ataccccctacagaactacattttggggagaaatggttccacaagaaggtggagaagagg
acgagtgccgagaagttgctgcaggaatactgcatggagacggggggcaaggatggcacc
ttcctggttcgggagagcgagaccttccccaatgactacaccctgtccttctggcggtca
ggccgggtccagcactgccggatccgctccaccatggagggcgggaccctgaaatactac
ttgactgacaacctcaccttcagcagcatctatgccctcatccagcactaccgcgagaca
cacctgcgctgcgccgagttcgagctgcggctcacggaccctgtgcccaaccccaacccc
cacgagtccaagccgtggtactatgacagcctgagccgtggagaggcagaggacatgctg
atgaggattccccgggacggggccttcctgatccggaagcgagaggggagcgactcctat
gccatcacgttcagggctaggggcaaggtaaagcattgtcgcatcaaccgggacggccgg
cactttgtgctggggacctccgcctattttgagagtctggtggagctcgtcagttactac
gagaagcattcactctaccgaaagatgagactgcgctaccccgtgacccccgagctcctg
gagcgctacaatatggaaagagatataaactccctctacgacgtcagcagaatgtatgtg
gatcccagtgaaatcaatccgtccatgcctcagagaaccgtgaaagctctgtatgactac
aaagccaagcgaagcgacgagctgagcttctgccgtggtgccctcatccacaatgtctcc
aaggagcccgggggctggtggaaaggagactatggaaccaggatccagcagtacttccca
tccaactacgtcgaggacatctcaactgcagacttcgaggagctagaaaagcagattatt
gaagacaatcccttagggtctctttgcagaggaatattggacctcaatacctataacgtc
gtgaaagcccctcagggaaaaaaccagaagtcctttgtcttcatcctggagcccaagaag
cagggcgatcctccggtggagtttgccacagacagggtggaggagctctttgagtggttt
cagagcatccgagagatcacctggaagattgacaccaaggagaacaacatgaagtactgg
gagaagaaccagtccatcgccatcgagctctctgacctggttgtctactgcaaaccaacc
agcaaaaccaaggacaacttagaaaatcctgacttccgagaaatccgctcctttgtggag
acgaaggctgacagcatcatcagacagaagcccgtcgacctcctgaagtacaatcaaaag
ggcctgacccgcgtctacccaaagggacaaagagttgactcttcaaactacgaccccttc
cgcctctggctgtgcggttctcagatggtggcactcaatttccagacgccagataagtac
atgcagatgaatcacgcgttgttttctctcaatgggcgcacgggctacgttctgcagcct
gagagcatgaggacagagaaatatgacccgatgccacccgagtcccagaggaagatcctg
atgacgctgacagtcaaggttctcggtgctcgccatctccccaaacttggacgaagtatt
gcctgtccctttgtagaagtggagatctgtggagccgagtatgacaacaacaagttcaag
acgacggttgtgaatgataatggcctcagccctatctgggctccaacacaggagaaggtg
acatttgaaatttatgacccaaacctggcatttctgcgctttgtggtttatgaagaagat
atgttcagcgatcccaactttcttgctcatgccacttaccccattaaagcaatcaaatca
ggattcaggtccattcctctgaagaatgggtacagcgaggacatagagctggcttccctc
ctggttttctgtgagatgcggccagtcctggagagcgaagaggaactttactcctcctgt
cgccagctgaggaggcggcaagaagaactgaacaaccagctctttctgtatgacacacac
cagaacttgcgcaatgccaaccgggatgccctggttaaagagttcagtgttaatgagaac
cagctccagctgtaccaggagaaatgcaacaagaggttaagagagaagagagtcagcaac
agcaagttttactcatag

KEGG   Pan troglodytes (chimpanzee): 458253
Entry
458253            CDS       T01005                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr00562  Inositol phosphate metabolism
ptr01100  Metabolic pathways
ptr01521  EGFR tyrosine kinase inhibitor resistance
ptr04012  ErbB signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04020  Calcium signaling pathway
ptr04062  Chemokine signaling pathway
ptr04064  NF-kappa B signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04070  Phosphatidylinositol signaling system
ptr04072  Phospholipase D signaling pathway
ptr04360  Axon guidance
ptr04370  VEGF signaling pathway
ptr04613  Neutrophil extracellular trap formation
ptr04650  Natural killer cell mediated cytotoxicity
ptr04658  Th1 and Th2 cell differentiation
ptr04659  Th17 cell differentiation
ptr04660  T cell receptor signaling pathway
ptr04664  Fc epsilon RI signaling pathway
ptr04666  Fc gamma R-mediated phagocytosis
ptr04670  Leukocyte transendothelial migration
ptr04722  Neurotrophin signaling pathway
ptr04750  Inflammatory mediator regulation of TRP channels
ptr04919  Thyroid hormone signaling pathway
ptr04933  AGE-RAGE signaling pathway in diabetic complications
ptr04935  Growth hormone synthesis, secretion and action
ptr05012  Parkinson disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05135  Yersinia infection
ptr05167  Kaposi sarcoma-associated herpesvirus infection
ptr05170  Human immunodeficiency virus 1 infection
ptr05171  Coronavirus disease - COVID-19
ptr05200  Pathways in cancer
ptr05205  Proteoglycans in cancer
ptr05206  MicroRNAs in cancer
ptr05214  Glioma
ptr05223  Non-small cell lung cancer
ptr05225  Hepatocellular carcinoma
ptr05231  Choline metabolism in cancer
ptr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
ptr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    458253 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    458253 (PLCG1)
   04014 Ras signaling pathway
    458253 (PLCG1)
   04015 Rap1 signaling pathway
    458253 (PLCG1)
   04370 VEGF signaling pathway
    458253 (PLCG1)
   04064 NF-kappa B signaling pathway
    458253 (PLCG1)
   04066 HIF-1 signaling pathway
    458253 (PLCG1)
   04020 Calcium signaling pathway
    458253 (PLCG1)
   04070 Phosphatidylinositol signaling system
    458253 (PLCG1)
   04072 Phospholipase D signaling pathway
    458253 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    458253 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    458253 (PLCG1)
   04660 T cell receptor signaling pathway
    458253 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    458253 (PLCG1)
   04659 Th17 cell differentiation
    458253 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    458253 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    458253 (PLCG1)
   04670 Leukocyte transendothelial migration
    458253 (PLCG1)
   04062 Chemokine signaling pathway
    458253 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    458253 (PLCG1)
   04919 Thyroid hormone signaling pathway
    458253 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    458253 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    458253 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    458253 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    458253 (PLCG1)
   05206 MicroRNAs in cancer
    458253 (PLCG1)
   05205 Proteoglycans in cancer
    458253 (PLCG1)
   05231 Choline metabolism in cancer
    458253 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    458253 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    458253 (PLCG1)
   05214 Glioma
    458253 (PLCG1)
   05223 Non-small cell lung cancer
    458253 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    458253 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    458253 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    458253 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    458253 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    458253 (PLCG1)
   05171 Coronavirus disease - COVID-19
    458253 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    458253 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    458253 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptr04131]
    458253 (PLCG1)
Enzymes [BR:ptr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     458253 (PLCG1)
Membrane trafficking [BR:ptr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    458253 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    458253 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 PH C2 SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 458253
NCBI-ProteinID: XP_009435516
Ensembl: ENSPTRG00000013500
VGNC: 6244
LinkDB
Position
20
AA seq 1330 aa
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVGQSVFPVIL
LILLGHCKPLPTSHPILSQGDLKPFVVAFTVDNGLNPVWPAKPFHFQISNPEFAFLRFVV
YEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLIKIDIFPAKQENGDL
SPFSGTSLRERGSDATGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFDSRERRAPR
RTRVNGDNRL
NT seq 3993 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccttgcgccaacggctgcgggcccggcgcgccctcggacgcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcgacccgagcggaagaccttccaggtcaagctggagacgcgccagatc
acgtggagccggggcgccgacaagatcgagggggctattgacattcgtgaaattaaggag
atccgcccagggaagacctcacgggactttgatcgctatcaagaggacccagctttccgg
ccggaccagtcacattgctttgtcattctctatggaatggaatttcgcctgaaaacgctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggctg
atggaggatacattgcaggcacccacacccctgcagattgagaggtggctccggaagcag
ttttactcagtggatcggaatcgtgaggatcgtatatcagccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgagagcggctgacggac
ctggagcagcgcagcggggacatcacctacgggcagtttgctcaactgtaccgcagcctc
atgtacagcgcccagaagacgatggacctccccttcttggaagccagtactctgagggct
ggggagcggccggagctttgccgagtgtcccttcctgagttccagcagttccttcttgac
taccagggggagctgtgggctgttgatcgcctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttacgagagatcgaggagccatacttcttcctggatgagtttgtcact
ttcctgttctccaaagagaacagtgtgtggaactcgcagctggatgcagtatgcccggac
accatgaacaaccctctttcccactactggatctcctcctcgcacaacacgtacctgacc
ggggaccagttctccagtgagtcctccttggaagcctatgctcgctgcctgcggatgggc
tgtcgctgcattgagttggactgctgggacggcccggatgggatgccagttatttaccat
gggcacacccttaccaccaagatcaagttctcagatgtcctgcacaccatcaaggagcat
gcctttgtggcctcagagtacccagtcatcctgtccattgaggaccactgcagcattgcc
cagcagaggaacatggcccaatacttcaagaaggtgctgggggacacactcctcaccaag
cccgtggagatctctgccgacgggctcccctcacccaaccagcttaagaggaagatcctc
atcaagcacaagaagctggctgagggcagtgcctacgaggaggtgcctacatccatgatg
tactctgagaacgacatcagcaactctatcaagaatggcatcctctacctggaggaccct
gtgaaccacgaatggtatccccactactttgttctgaccagcagcaagatctactactct
gaggagaccagcagtgaccagggcaacgaggatgaggaggagcccaaggaggtcagcagc
agcacagagctgcactccaatgagaagtggttccatgggaagctaggggcagggcgtgac
gggcgtcacatcgctgagcgcctgcttactgagtactgcatcgagaccggagcccctgac
ggctccttcctcgtgcgagagagtgagaccttcgtgggcgactacacgctctctttctgg
cggaacgggaaagtccagcactgccgtatccactcccggcaagatgctgggacccccaag
ttcttcttgacagacaacctcgtctttgactccctctatgacctcatcacgcactaccag
caggtgcccctgcgctgtaatgagtttgagatgcgactttcagagcctgtcccacagacc
aacgcccacgagagcaaagagtggtaccacgcgagcctgaccagagcacaggctgagcac
atgctaatgcgtgtccctcgtgatggggccttcctggtgcggaagcggaatgagcccaac
tcatatgccatctctttccgggctgagggcaagatcaagcattgccgtgtccagcaagag
ggccagacagtgatgctagggaactcggagttcgacagccttgttgacctcatcagctac
tatgagaaacacccgctataccgcaagatgaagctgcgctatcccatcaacgaggaggca
ctggagaagattggcacagctgagcctgactacggggccctgtatgagggacgcaaccct
ggcttctatgtagaggcaaaccctatgccaactttcaagtgtgcagtcaaagccctcttt
gactacaaggcccagagggaggacgagctgaccttcaccaagagcgccatcatccagaat
gtggagaagcaagagggaggctggtggcgaggggactacggagggaagaagcagctgtgg
ttcccatcaaactacgtggaagagatggtcaaccccgtggccctggagccggagagggag
cacttggacgagaacagccccctaggggacttgctacggggggtcttggatgtgccggct
tgtcagattgccatccgtcctgagggcaagaacaaccggctcttcgtcttctccatcagc
atggcgtcggtggcccactggtccctggatgttgctgccgactcacaggaggagctgcag
gactgggtgaaaaagatccgtgaagtggcccagacagcagacgccaggctcactgaaggg
aagataatggaacggaggaagaagattgccctggagctctctgaacttgtcgtctactgc
cggcctgttcccttcgatgaagagaagattggcacagaacgtgcttgctaccgggacatg
tcatccttcccggaaaccaaggctgagaaatacgtgaacaaggccaaaggcaagaagttc
cttcagtacaatcgactgcagctctcccgcatctaccccaagggccagcgactggattcc
tccaactacgatcctttgcccatgtggatctgtggcagtcagcttgtggccctcaacttc
cagacccctgacaagcctatgcagatgaaccaggccctcttcatgacgggcaggcactgt
ggctacgtgctgcagccaagcaccatgcgggatgaggccttcgacccctttgacaagagc
agcctccgcgggctggagccatgtgccatctctattgaggtgctgggggcccgacatctg
ccaaagaatggccgaggcattgtgtgtccttttgtggagattgaggtggctggagctgag
tatgacagcaccaagcagaagacagagtttgtgggtcagtctgtcttcccagtcatcctc
ctcatcctgctggggcactgcaagcctctccccaccagtcatcccatcctctcccagggt
gacctgaagccttttgtcgttgccttcacagtggacaatggactcaaccctgtatggcca
gccaagcccttccacttccagatcagtaaccctgaatttgcctttctgcgcttcgtggtg
tatgaggaagacatgtttagtgaccagaatttcctggctcaggctactttcccagtaaaa
ggcctgaagacaggatacagagcagtgcctttgaagaataactacagtgaggacctggag
ttggcctccctgctgatcaagattgacattttccctgccaagcaggagaatggtgacctc
agtcccttcagtggtacgtccctgcgggagcggggctcagatgccacaggccagctgttt
cacggccgagcccgggaaggctcctttgaatcccgctaccagcagccgtttgaggacttc
cgcatctcccaggagcatctcgcagaccattttgacagtcgagaacgaagggccccaaga
aggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system