KEGG   Pan troglodytes (chimpanzee): 466915
Entry
466915            CDS       T01005                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04020  Calcium signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04024  cAMP signaling pathway
ptr04260  Cardiac muscle contraction
ptr04261  Adrenergic signaling in cardiomyocytes
ptr04270  Vascular smooth muscle contraction
ptr04713  Circadian entrainment
ptr04720  Long-term potentiation
ptr04723  Retrograde endocannabinoid signaling
ptr04724  Glutamatergic synapse
ptr04725  Cholinergic synapse
ptr04726  Serotonergic synapse
ptr04727  GABAergic synapse
ptr04728  Dopaminergic synapse
ptr04742  Taste transduction
ptr04911  Insulin secretion
ptr04912  GnRH signaling pathway
ptr04921  Oxytocin signaling pathway
ptr04924  Renin secretion
ptr04925  Aldosterone synthesis and secretion
ptr04927  Cortisol synthesis and secretion
ptr04929  GnRH secretion
ptr04930  Type II diabetes mellitus
ptr04934  Cushing syndrome
ptr04935  Growth hormone synthesis, secretion and action
ptr05010  Alzheimer disease
ptr05020  Prion disease
ptr05022  Pathways of neurodegeneration - multiple diseases
ptr05031  Amphetamine addiction
ptr05410  Hypertrophic cardiomyopathy
ptr05412  Arrhythmogenic right ventricular cardiomyopathy
ptr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    466915 (CACNA1C)
   04020 Calcium signaling pathway
    466915 (CACNA1C)
   04024 cAMP signaling pathway
    466915 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    466915 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    466915 (CACNA1C)
   04929 GnRH secretion
    466915 (CACNA1C)
   04912 GnRH signaling pathway
    466915 (CACNA1C)
   04921 Oxytocin signaling pathway
    466915 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    466915 (CACNA1C)
   04924 Renin secretion
    466915 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    466915 (CACNA1C)
   04927 Cortisol synthesis and secretion
    466915 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    466915 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    466915 (CACNA1C)
   04270 Vascular smooth muscle contraction
    466915 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    466915 (CACNA1C)
   04727 GABAergic synapse
    466915 (CACNA1C)
   04725 Cholinergic synapse
    466915 (CACNA1C)
   04728 Dopaminergic synapse
    466915 (CACNA1C)
   04726 Serotonergic synapse
    466915 (CACNA1C)
   04720 Long-term potentiation
    466915 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    466915 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    466915 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    466915 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    466915 (CACNA1C)
   05020 Prion disease
    466915 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    466915 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    466915 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    466915 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    466915 (CACNA1C)
   05414 Dilated cardiomyopathy
    466915 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    466915 (CACNA1C)
   04934 Cushing syndrome
    466915 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ptr04040]
    466915 (CACNA1C)
Ion channels [BR:ptr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   466915 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 466915
NCBI-ProteinID: XP_016778223
VGNC: 51248
LinkDB
Position
12
AA seq 2251 aa
MPLTPNLDSSLGPLQSRMTRGWPDRAGVLPSSWSPAAAPGCRRRMQMLSSGELGHLTGSN
YGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSST
QRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCV
ALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLD
FIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLN
SIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALE
TGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRD
WPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLD
WITQAEDIDPENEDEGMDEEKPRNRGTPAGMLDQKKGKFAWFSHSTETHVSMPTSETESV
NTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLV
FLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCF
VVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASL
LLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYD
GIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKE
RKKLARTASPEKKQELVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDK
SPYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCH
RIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTA
YGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYI
TYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGP
IYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYAL
KARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNIL
NMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTF
DALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGI
RTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAV
LLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFL
IINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQP
PLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEEGPSPSEAHQG
AEDPFRPAGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEY
FRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAV
SAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEK
LVDSTFTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSPAIRVQEV
AWKLSSNRCHSRESQAAMAGQEETSQDETYEVKMNHDAEACSEPSLLSTEMLSYQDDENR
QLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHH
QALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQLVPTLRLEGVESSEKLNSSF
PSIHCGSWAETTPGGGGSSAARRARPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLG
QFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDR
AGGEEDAGCVRARGRLSEEELQDSRVYVSSL
NT seq 6756 nt   +upstreamnt  +downstreamnt
atgccactgactcctaacttggactcctcacttggacccttgcagagcagaatgacacga
ggctggccagaccgtgctggggtcctgccctcatcctggtccccagcagcagcacctggg
tgcaggaggaggatgcagatgctgtcttcaggggagctgggccatttgacaggttccaac
tatgggagcccacgccccgcccatgccaacatgaatgccaatgcggcagcggggctggcc
cctgagcacatccccaccccgggggccgccctgtcctggcaggcggccatcgacgcagcc
cggcaggctaagctgatgggcagcgctggcaatgcgaccatctccacagtcagctccacg
cagcggaagcggcagcaatatgggaaacccaagaagcagggcagcaccacggccacacgc
ccgccccgagccctgctctgcctgaccctgaagaaccccatccggagggcctgcatcagc
attgtcgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtg
gccttagcgatctatattccctttccagaagatgattccaacgccaccaattccaacctg
gaacgagtggaatatctctttctcataatttttacggtggaagcgtttttaaaagtaatc
gcctatggactcctctttcaccccaatgcctacctccgcaacggctggaacctactagat
tttataattgtggttgtggggctttttagtgcaattttagaacaagcaaccaaagcagat
ggggcaaacgctctcggagggaaaggggccggatttgatgtgaaggcgctgagggccttc
cgcgtgctgcgccccctgcggctggtgtccggagtcccaagtctccaggtggtcctgaat
tccatcatcaaggccatggtccccctgctgcacatcgccctgcttgtgctgtttgtcatc
atcatctacgccatcatcggcttggagctcttcatggggaagatgcacaagacctgctac
aaccaggagggcatagcagatgttccagcagaagatgacccttccccttgtgcgctggaa
acgggccatgggcggcagtgccagaacggcacggtgtgcaagcccggctgggatggtccc
aagcacggcatcaccaactttgacaactttgccttcgccatgctcacggtgttccagtgc
atcaccatggagggctggacggacgtgctgtactgggtcaatgatgccgtaggaagggac
tggccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttg
gttctcggtgtgcttagcggagagttttccaaagagagggagaaggccaaggcccgggga
gatttccagaagctgcgggagaagcagcagctagaagaggatctcaaaggctacctggat
tggatcactcaggccgaagacatcgatcccgagaatgaggacgaaggcatggatgaggag
aagccccgaaacagaggcactccggcgggcatgcttgatcagaagaaagggaagtttgct
tggtttagtcactccacagaaacccatgtgagcatgcccaccagtgagaccgagtccgtc
aacaccgaaaacgtggctggaggtgacatcgagggagaaaactgcggggccaggctggcc
caccggatctccaagtcaaagttcagccgctactggcgccggtggaatcggttctgcaga
aggaagtgccgcgccgcagtcaagtctaatgtcttctactggctggtgattttcctggtg
ttcctcaacacgctcaccattgcctctgagcactacaaccagccccactggctcacagaa
gtccaagacacggcgaacaaggccctgctggccctgttcacggcggagatgctcctgaag
atgtacagcctgggcctgcaggcctacttcgtgtccctcttcaaccgctttgactgcttc
gtcgtgtgtggcggcatcctggagaccatcctggtggagaccaagatcatgtccccactg
ggcatctccgtgctcagatgcgtccggctgctgaggattttcaagatcacgaggtactgg
aactccttgagcaacctggtggcatccttgctgaactctgtgcgctccatcgcctccctg
ctccttctcctcttcctcttcatcatcatcttctccctcctggggatgcagctctttgga
ggaaagttcaactttgatgagatgcagacccggaggagcacattcgataacttcccccag
tccctcctcactgtgtttcagatcctgaccggggaggactggaattcggtgatgtatgat
gggatcatggcttatggcggcccctcttttccagggatgttagtctgtatttacttcatc
atcctcttcatctgtggaaactatatcctactgaatgtgttcttggccattgctgtggac
aacctggctgatgctgagagcctcacatctgcccaaaaggaggaggaagaggagaaggag
agaaagaagctggccaggactgccagcccagagaagaaacaagagttggtggagaagcca
gcagtgggggaatccaaggaggagaagattgagctgaaatccatcacggctgacggagag
tctccacccgccaccaagatcaacatggatgacctccagcccaatgaaaatgaggataag
agcccctaccccaacccagaaactacaggagaagaggatgaggaggagccagagatgcct
gtcggccctcgcccacgaccactctctgagcttcaccttaaggaaaaggcagtgcccatg
ccagaagccagcgcgtttttcatcttcagctctaacaacaggtttcgcctccagtgccac
cgcattgtcaatgacacgatcttcaccaacctgatcctcttcttcattctgctcagcagc
atttccctggctgctgaggacccggtccagcacacctccttcaggaaccatattctgttt
tattttgatattgtttttaccaccattttcaccattgaaattgctctgaagatgactgct
tatggggctttcctgcacaagggctctttctgccggaactacttcaacatcctggacctg
ctggtggtcagcgtgtccctcatctcctttggcatccagtccagtgcaatcaatgtcgtg
aagatcttgcgagtcctgcgagtactcaggcccctgagggccatcaacagggccaagggg
ctaaagcatgtggttcagtgtgtgtttgtcgccatccggaccatcgggaacatcgtgatt
gtcaccaccctgctgcagttcatgtttgcctgcatcggggtccagctcttcaagggaaag
ctgtacacctgttcagacagttccaagcagacagaggcggaatgcaagggcaactacatc
acatacaaagacggggaggttgaccaccccatcatccaaccccgcagctgggagaacagc
aagtttgactttgacaatgttctggcagccatgatggccctcttcaccgtctccaccttc
gaagggtggccagagctgctgtaccgctccatcgactcccacacggaagacaagggcccc
atctacaactaccgtgtggagatctccatcttcttcatcatctacatcatcatcatcgcc
ttcttcatgatgaacatcttcgtgggcttcgtcatcgtcacctttcaggagcagggggag
caggagtacaagaactgtgagctggacaagaaccagcgacagtgcgtggaatacgccctc
aaggcccggcccctgcggaggtacatccccaagaaccagcaccagtacaaagtgtggtac
gttgtcaactccacctacttcgagtacctgatgttcgtcctcatcctgctcaacaccatc
tgcctggccatgcagcactacggccagagctgcctgttcaaaatcgccatgaacatcctc
aacatgctcttcactggcctcttcaccgtggagatgatcctgaagctcattgccttcaaa
cccaagggttactttagtgatccctggaatgtttttgacttcctcatcgtaattggcagc
ataattgacgtcattctcagtgagactaatcactatttctgtgatgcatggaatacattt
gacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtaaacccagct
gaacatacccaatgctctccctctatgaacgcagaggaaaactcccgcatctccatcacc
ttcttccgcctgttccgggtcatgcgtctggtgaagctgctgagccgtggggagggcatc
cggacgctgctgtggaccttcatcaagtccttccaggccctgccctatgtggccctcctg
atcgtgatgctgttcttcatctacgcggtgatcgggatgcaggtgtttgggaaaattgcc
ctgaatgataccacagagatcaaccggaacaacaactttcagaccttcccccaggctgtg
ctgctcctcttcaggtgtgccaccggggaggcctggcaggacatcatgctggcctgcatg
ccaggcaagaagtgtgccccggagtcagagcccagcaacagcacggagggtgaaacaccc
tgtggtagcagctttgctgtcttctacttcatcagcttctacatgctctgtgccttcctg
atcatcaacctctttgtagctgtcatcatggacaactttgactacctgacaagggactgg
tccatccttggtccccaccacctggatgagtttaaaagaatctgggcagagtatgaccct
gaagccaagggtcgtatcaaacacctggatgtggtgaccctcctccggcggattcagcca
ccactaggtttcgggaagctgtgccctcaccgcgtggcttgcaaacgcctggtctccatg
aacatgcctctgaacagcgacgggacagtcatgttcaatgccactctgtttgccctggtc
aggacggccctgaggatcaaaacagaagagggacccagcccatcagaggcccaccaaggg
gctgaggatcctttccgccctgcagggaacctagaacaagccaatgaggagctgcgggcg
atcatcaagaagatctggaagcggaccagcatgaagctgctggaccaggtggtgccccct
gcaggtgatgatgaggtcaccgttggcaagttctacgccacgttcctgatccaggagtac
ttccggaagttcaagaagcgcaaagagcagggccttgtgggcaagccctcccagaggaac
gcactgtctctgcaggctggcttgcgcacactgcatgacatcgggcctgagatccgacgg
gccatctctggagatctcaccgctgaggaggagctggacaaggccatgaaggaggctgtg
tccgctgcttctgaagatgacatcttcaggagggccggtggcctgttcggcaaccacgtc
agctactaccaaagcgacggccggagcgccttcccccagaccttcaccactcagcgcccg
ctgcacatcaacaaggcgggcagcagccagggcgacactgagtcgccatcccacgagaag
ctggtggactccaccttcaccccgagcagctactcgtccaccggctccaatgccaacatc
aacaacgccaacaacaccgccctgggtcgcctccctcgccccgccggctaccccagcacg
gtcagcactgtggagggccacgggccccccttgtcccctgccatccgggtgcaggaggtg
gcgtggaagctcagctccaacaggtgccactcccgggagagccaggcagccatggcgggt
caggaggagacgtctcaggatgagacctatgaagtgaagatgaaccatgacgcggaggcc
tgcagtgagcccagcctgctctccacagagatgctctcctaccaggatgacgaaaatcgg
caactgacgctcccagaggaggacaagagggacatccggcaatctccaaagaggggtttc
ctccgctctgcctcactaggtcgaagggcctccttccacctggaatgtctgaagcgacag
aaggaccgagggggagacatctctcagaagacagtcctgcccttgcatctggttcatcat
caggcattggcagtggcaggcctgagccccctcctccagagaagccattcccctgcctca
ttccctaggccttttgccaccccaccagccacacctggtagccgaggctggcccccacag
ctcgtccccaccctgcggctggagggggtcgagtccagtgagaaactcaacagcagcttc
ccatccatccactgcggatcctgggctgagaccacccccggtggcgggggcagcagcgcc
gcccggagagcccggcccgtctccctcatggtgcccagccaggctggggccccagggagg
cagttccacggcagtgccagcagcctggtggaagcggtcttgatttcagaaggactgggg
cagtttgctcaagatcccaagttcatcgaggtcaccacccaggagctggccgacgcctgc
gacatgaccatagaggagatggagagcgcggccgacaacatcctcagcgggggcgcccca
cagagccccaatggcgccctcttaccctttgtgaactgcagggacgcggggcaggaccga
gccgggggcgaagaggacgcgggctgtgtgcgcgcgcggggtcgactgagtgaggaggag
ctccaggacagcagggtctacgtcagcagcctgtag

DBGET integrated database retrieval system