KEGG   Ursus maritimus (polar bear): 103658585
Entry
103658585         CDS       T03271                                 

Gene name
RALB
Definition
(RefSeq) RAS like proto-oncogene B
  KO
K07835  Ras-related protein Ral-B
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04072  Phospholipase D signaling pathway
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103658585 (RALB)
   04015 Rap1 signaling pathway
    103658585 (RALB)
   04072 Phospholipase D signaling pathway
    103658585 (RALB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103658585 (RALB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103658585 (RALB)
   05212 Pancreatic cancer
    103658585 (RALB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103658585 (RALB)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:umr04031]
    103658585 (RALB)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    103658585 (RALB)
GTP-binding proteins [BR:umr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    103658585 (RALB)
SSDB
Motif
Pfam: Ras Roc RsgA_GTPase Arf GTP_EFTU MMR_HSR1 Gtr1_RagA AAA_25 FeoB_N Ser_hydrolase
Other DBs
NCBI-GeneID: 103658585
NCBI-ProteinID: XP_008684324
UniProt: A0A384BPY9
LinkDB
Position
Un
AA seq 238 aa
MWEVTRSRDDTRAASSSTRSSVRVSQPQKTSRMAANKSKSQSSLALHKVIMVGSGGVGKS
ALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEG
FLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPIEEARSKAE
EWGVQYVETSAKTRANVDKVFFDLMREIRAKKMSENKDKNGKKSSKNKKSFKERCCLL
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtgggaagtgacgaggtccagggatgatacgagggcagcaagctcttcaactaggtct
tctgttcgtgtgtcgcaacctcagaaaaccagcaggatggccgcaaacaagagtaagagc
cagagttccttggcccttcacaaggtgatcatggttggcagtggaggggttggcaagtcg
gccctgacgcttcagttcatgtatgatgagtttgtagaagactatgaacctaccaaagct
gacagttacagaaagaaagtggttcttgatggagaagaagtccagatagatatcctggac
acggctggacaagaggactacgcggccattcgggacaactacttccgcagcggggaaggc
ttcctcctcgtgttttcaatcacagaacacgagtcgtttacagcgactgccgagttcagg
gaacagatcctccgcgttaaggctgaagaagataaaattccattgcttgtcgtgggaaac
aagtccgacctcgaggagcgaaggcaggtgcccatcgaagaggctaggagtaaagcagag
gagtggggcgtgcagtatgtggagacatcggctaaaacgcgggccaatgtggacaaggtg
ttctttgacctaatgagagaaatcagagccaaaaagatgtctgagaataaagacaagaac
ggcaagaaaagcagcaagaacaagaaaagttttaaagaaagatgttgcttactgtga

KEGG   Ursus maritimus (polar bear): 103674594
Entry
103674594         CDS       T03271                                 

Gene name
RALA
Definition
(RefSeq) RAS like proto-oncogene A
  KO
K07834  Ras-related protein Ral-A
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04072  Phospholipase D signaling pathway
umr05132  Salmonella infection
umr05200  Pathways in cancer
umr05210  Colorectal cancer
umr05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103674594 (RALA)
   04015 Rap1 signaling pathway
    103674594 (RALA)
   04072 Phospholipase D signaling pathway
    103674594 (RALA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103674594 (RALA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103674594 (RALA)
   05212 Pancreatic cancer
    103674594 (RALA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103674594 (RALA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103674594 (RALA)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:umr04031]
    103674594 (RALA)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    103674594 (RALA)
GTP-binding proteins [BR:umr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ral
    103674594 (RALA)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_25 MMR_HSR1_Xtn ThiF ATP_bind_1
Other DBs
NCBI-GeneID: 103674594
NCBI-ProteinID: XP_008701725
UniProt: A0A384D4Q3
LinkDB
Position
Un
AA seq 206 aa
MATNKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKTRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL
NT seq 621 nt   +upstreamnt  +downstreamnt
atggctacaaacaagcccaagggtcagaattctctggccctgcacaaagtcatcatggtg
ggcagtggcggtgtgggcaagtccgctctgaccctacagttcatgtatgatgagtttgtg
gaagactatgagcctaccaaagcagacagctatcggaagaaggtggtgctggatggggag
gaagtgcagatcgacatcttggataccgctgggcaggaggattatgccgcaattagagac
aactacttccggagcggggagggtttcctctgtgtcttctctattacagaaatggaatcc
tttgcagccacagccgatttcagggagcagattttaagagtaaaagaagatgagaacgtt
ccatttctgctggttggtaacaaatcagatttagaagataaaaggcaggtttccgtagaa
gaggcaaaaaccagagccgaccagtggaatgtgaactatgtggaaacatctgctaaaact
cgagctaatgttgacaaggtattttttgatctgatgagggaaattcgagccagaaagatg
gaagacagcaaagaaaagaacggaaaaaagaagaggaaaagtttagccaagagaatcaga
gaaagatgctgcattttataa

DBGET integrated database retrieval system