KEGG   Aeropyrum camini: ACAM_0997
Entry
ACAM_0997         CDS       T02858                                 

Symbol
cysK
Name
(GenBank) cysteine synthase
  KO
K10150  cysteine synthase / O-phosphoserine sulfhydrylase / cystathionine beta-synthase [EC:2.5.1.47 2.5.1.65 4.2.1.22]
Organism
acj  Aeropyrum camini
Pathway
acj00260  Glycine, serine and threonine metabolism
acj00270  Cysteine and methionine metabolism
acj00920  Sulfur metabolism
acj01100  Metabolic pathways
acj01110  Biosynthesis of secondary metabolites
acj01120  Microbial metabolism in diverse environments
acj01230  Biosynthesis of amino acids
Module
acj_M00035  Methionine degradation
acj_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:acj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ACAM_0997 (cysK)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACAM_0997 (cysK)
   00270 Cysteine and methionine metabolism
    ACAM_0997 (cysK)
Enzymes [BR:acj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     ACAM_0997 (cysK)
    2.5.1.65  O-phosphoserine sulfhydrylase
     ACAM_0997 (cysK)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     ACAM_0997 (cysK)
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: BAN90466
UniProt: U3TDG0
LinkDB
Position
956125..957273
AA seq 382 aa
MPLADISGYLEVLDSVRGFSYLETARGVLRRGAAGCVSNPREKPGYVKALYVIGAVKIPV
GEGCSYTLEELGVYDIGGAPDMVFSSPLDLFTRGKPTPLVRSRLQLPGGVRLWLKLEWYN
PFSLSVKDRPAVEIVSRLSRRVEKGSLVGDATSSNFGIALSAVARLYGYKARVYLPGAAE
DFGKTLPRLLGAEVIVDPEAPSTVHLLPRVMKDARSGGLVHVNQFYNDANFEAHMRGTAR
EIFVQSRRGGLRLKGVSGSLGTSGHMSAVAFYLQSVDPGVKAVLVQPAKDASIPGIRRVE
TGMLWINMLDIDYSLAEVTLEEAVEAMAEVARSDGLIIGPSGGAAVKALAKKAGEGELEP
GDYVVVVPDTGFKYVNLVKQLL
NT seq 1149 nt   +upstreamnt  +downstreamnt
gtgcctttagctgatataagcgggtatctggaggttctagactctgtacgaggtttctcc
tatcttgagacagctaggggtgtgttgaggaggggcgcggccgggtgcgtctccaacccc
agggagaagccagggtatgtgaaggcactctacgttataggagctgtcaagataccggtg
ggggagggatgcagctacaccctggaggagctgggtgtttacgatatcggcggggccccg
gatatggtgttctcctcgcccctagacctcttcacgagagggaagccgacgcctctagtt
aggtcccgcctccagctgccagggggagttaggctctggctaaagctagagtggtacaat
cccttcagcctcagcgtgaaggataggccggctgtagagattgtttccaggctctccaga
agggtggagaagggctcgctagtcggagacgccacttcctcgaactttggtatagcgcta
tccgctgtagccaggctctacgggtacaaggcccgcgtctacctgcctggtgctgctgag
gatttcgggaagacactcccccggctgctcggcgccgaggttattgtagatcctgaagcg
ccctcgacagtccacctcctcccccgggttatgaaagatgccaggagcgggggcctggtc
catgtaaaccagttctacaacgacgcaaacttcgaggcccacatgagggggactgcgcgg
gagattttcgtccagtcccgcaggggaggactcaggctaaaaggcgtctccgggagtcta
ggcacctccgggcacatgtccgcagtcgccttctacctccagagcgtcgaccctggggtt
aaagcggttctagtgcagccagcaaaggatgcttccataccggggataaggagggttgag
acggggatgctctggataaacatgctcgacatcgactacagcctggccgaggtgaccctg
gaggaggcggtggaggctatggcggaggtcgcccggagcgacggcctaattataggcccc
tcgggcggcgctgctgtgaaggctctggcaaagaaagctggcgaaggagagcttgagcct
ggcgactacgttgttgtagtgcccgacacaggattcaaatacgtaaacctagtcaagcag
ctcctctaa

DBGET integrated database retrieval system