KEGG   Azotobacter chroococcum: Achr_26820
Entry
Achr_26820        CDS       T03640                                 
Name
(GenBank) Type I secretion outer membrane protein, TolC family
  KO
K12340  outer membrane protein
Organism
acx  Azotobacter chroococcum
Pathway
acx01501  beta-Lactam resistance
acx01503  Cationic antimicrobial peptide (CAMP) resistance
acx02020  Two-component system
acx03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:acx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Achr_26820
  09132 Signal transduction
   02020 Two-component system
    Achr_26820
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Achr_26820
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Achr_26820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:acx02000]
    Achr_26820
   02044 Secretion system [BR:acx02044]
    Achr_26820
   01504 Antimicrobial resistance genes [BR:acx01504]
    Achr_26820
Transporters [BR:acx02000]
 Other transporters
  Pores ion channels [TC:1]
   Achr_26820
Secretion system [BR:acx02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Achr_26820
  RTX toxin transporter
   Achr_26820
  Multiple protein transporter
   Achr_26820
  RaxAB-RaxC type I secretion system protein
   Achr_26820
Antimicrobial resistance genes [BR:acx01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    Achr_26820
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    Achr_26820
SSDB
Motif
Pfam: OEP Taxilin
Other DBs
NCBI-ProteinID: AJE22108
UniProt: A0A0C4WIJ6
LinkDB
Position
complement(3036805..3038217)
AA seq 470 aa
MRRCSICLLLAVLAVSVQAETLRKEPASVSLAARRQGVSISEYSVDLMQLYREARLEDPR
VLAAYARAQSGKDRQREALGGLLPQVSANTAFSRSTRDDDLDRTSYDTERYSVSLTQHIY
NKVAWENYQKSKSLARQGEAEAEDVHAEATVDLAQRYFVALAAEDELELVMAERRATQRN
LDRIKALYEKQMAMITDVLDLQSRVDALAASELEARNQMEVSRQELAELVGRPVKENLSR
IREDIQMQAPAESMDVWIERAIAANPALKSRESALAAASAALRGGKGGHYPSLSLNLSAL
RSDAGYDNNQSSRYDNYTASVGVQVPIYSGGATSARVRALHGDMTAAEQELESTRREVVK
EITSAYLTANSSVERIRASRNALESAEKSTVAAERGFQFGVVNAVDVLTSVKTEYEARRD
LLKAQYDFITNLLVLNRWAGKLSEQTIESVNVWLAHDGDARALKQGSSKE
NT seq 1413 nt   +upstreamnt  +downstreamnt
gtgcgccgttgttcaatttgcctgttgctggccgtgctggccgtatcggtacaggccgaa
acccttcggaaagagccggcttcggtctctctggctgcgcggcggcagggggtcagtatc
tcggaatatagcgtcgatctgatgcagttgtaccgcgaggcgcgtcttgaggatccacgg
gttctggccgcctatgcgcgcgctcagtctggcaaggatcgccagcgcgaagcattgggc
ggattgctgccgcaagtttccgctaataccgcattcagtcgcagcacgcgggacgatgat
ctcgatcgtacttcctatgacacagagcgttactccgttagcctgacccagcacatctac
aacaaggtcgcttgggaaaattaccagaaatccaagagcctcgcccgacagggcgaagct
gaggccgaagacgtgcatgccgaggcgaccgtagacttggcgcagcgctatttcgtcgct
ttggccgcggaagacgagctcgagctggtgatggcagaacgccgggcgactcagaggaat
ctggatcgcattaaagcgttgtatgaaaagcagatggctatgatcaccgatgttcttgac
ctgcagtcacgcgtcgatgcgctggctgcttcggagctcgaggcgcgcaaccagatggag
gtcagccgccaggaacttgccgaactcgtcggacggccagtgaaggaaaatctcagccgc
atacgtgaagatatccaaatgcaggcaccggccgaaagcatggacgtctggattgagcgc
gccatcgctgccaacccggcgctcaagagtcgagaaagcgcgcttgccgccgccagtgcg
gctcttcgtggaggaaagggggggcattacccttctctcagcctcaacctatcggccctg
cgcagtgatgctggttacgataacaaccagtcgtcacgctatgataactatactgccagt
gtcggggtgcaggtgcctatctatagtgggggggctacgtctgcacgcgtcagagcgttg
catggagatatgactgcggccgagcaagagcttgagtcaacgcggcgcgaagtggtcaag
gaaatcacaagtgcctacctcaccgccaactccagtgtggaaaggatccgtgcctcgcgc
aatgcgctggagtctgcagaaaagtccacggttgcggccgagcggggtttccagtttgga
gtcgtgaatgcggtcgacgtgttgaccagcgtaaagaccgaatacgaggcgcggcgcgat
cttctcaaggctcaatacgatttcattaccaatcttctggtattgaatcgttgggctggc
aagctgtcagagcaaacgatcgaaagcgtcaatgtatggctggcccacgatggtgacgcc
agggccctcaagcaaggctcatcgaaggagtga

DBGET integrated database retrieval system