KEGG   Addendum: AGC92397
Entry
AGC92397          CDS       T10000                                 
Symbol
CYP82N3
Name
(KEGG) protopine 6-monooxygenase
  KO
K21693  protopine 6-monooxygenase [EC:1.14.14.98]
Taxonomy
TAX:3469
  Lineage
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Ranunculales; Papaveraceae; Papaveroideae; Papaver
Organism
ag  Addendum (Papaver somniferum)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AGC92397
GB: KC154002
UniProt: L7X0L7
LinkDB
AA seq 541 aa
MDFSSLLLLLLNTWISAYSMAALLALVLVYNLRMTKSSSSKTTSLKGKKIITRPPAVTGA
WPVFGHLHLFGSGEHPHEMLSKLAEKYGPSFTMKFGKHTTLVVSDTRVVKECFTTNDTLF
SNRPSTIAFDLMTYATDSIAFTPYSPYWRELRKISTLKLLSNNRLESIKQLRTSEVSVCF
KELYDLTNKKNDNGAPVPIDLKRWFDEVSNNVIMRVIFGKQNFGSKIVLGEDQEAVHYKK
IMDELSRLSSLTMLSDMVPLLGWLDYFKGDLRAMKRNGKELNSILQKWLEEHKSKKSSDA
RQDFMDVMLSISKDTQLYGHDQDTFIKATCLAMIMGGTNSTEVALTWILSLLMNNRCALH
KAREEIDLLVGKDRQVEDSDVKNLTYMNAIIKETMRLYPLGFLLERDTKEDCEVSGFNIK
GGTRLLINVWKLQRDPNVWTDPMEFKPERFLTENADIDVGGQHFELLPFGAGRRVCPGVS
FALQFMHLVLARLIHGYDMETLNGEDVDLSVSSGGHVNIKSTPLELILTPRLHPELYDCE
T
Reference
  Authors
Beaudoin GA, Facchini PJ
  Title
Isolation and characterization of a cDNA encoding (S)-cis-N-methylstylopine 14-hydroxylase from opium poppy, a key enzyme in sanguinarine biosynthesis.
  Journal
Biochem Biophys Res Commun 431:597-603 (2013)
DOI:10.1016/j.bbrc.2012.12.129

DBGET integrated database retrieval system