Astyanax mexicanus (Mexican tetra): 103045108 Help Entry 103045108         CDS       T05042                                  Symbol pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex03030   DNA replication amex03410   Base excision repair amex03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:amex00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     103045108 (pole4)    03410 Base excision repair     103045108 (pole4)    03420 Nucleotide excision repair     103045108 (pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:amex03032]     103045108 (pole4)    03400 DNA repair and recombination proteins [BR:amex03400]     103045108 (pole4) Enzymes [BR:amex01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      103045108 (pole4) DNA replication proteins [BR:amex03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     103045108 (pole4) DNA repair and recombination proteins [BR:amex03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       103045108 (pole4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C TAF TFIID-31kDa Motif Other DBs NCBI-GeneID:  103045108 NCBI-ProteinID:  XP_007240286 Ensembl:  ENSAMXG00000034001 UniProt:  A0A8B9RJZ2 LinkDB All DBs Position 16:19172092..19176555 Genome browser AA seq 140 aa AA seqDB search MVSVLGGRIYTRRWRDMAATLVESGALGDSELDRSGAEEPRGEGEEDGAQHTSPAGGHSR LAKLPLSRIKALMKADPDLSLASQESVFIIAKATELFVEMIAKDALVYAQQGKRKTLQRK DLDNAIEAIDEFAFLEGTLD NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggtttcggttctcggggggcggatatatactcggcgctggagagacatggcggcgact ctagtggagagcggcgcgctcggggacagcgagctggaccggagcggagctgaagagccg cggggtgagggtgaggaggacggggctcagcacacgagccccgcggggggacacagccgg ctcgccaagctgccgctctcccgcatcaaagccctgatgaaggccgacccggacctgagc ctggccagccaggagtccgtcttcatcatcgctaaagccacggagctctttgtggaaatg atagccaaggatgcgcttgtctatgcacaacagggaaaaaggaaaactctgcagaggaaa gatctagacaatgcaattgaggcaatagatgaatttgcatttcttgaaggtactttggac tga

DBGET integrated database retrieval system