Astyanax mexicanus (Mexican tetra): 107197156 Help Entry 107197156         CDS       T05042                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism amex  Astyanax mexicanus (Mexican tetra) Pathway amex03420   Nucleotide excision repair amex04110   Cell cycle amex04114   Oocyte meiosis amex04120   Ubiquitin mediated proteolysis amex04141   Protein processing in endoplasmic reticulum amex04310   Wnt signaling pathway amex04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:amex00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107197156    04120 Ubiquitin mediated proteolysis     107197156   09124 Replication and repair    03420 Nucleotide excision repair     107197156  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107197156    04350 TGF-beta signaling pathway     107197156  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     107197156    04114 Oocyte meiosis     107197156  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:amex04121]     107197156    03400 DNA repair and recombination proteins [BR:amex03400]     107197156 Enzymes [BR:amex01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107197156 Ubiquitin system [BR:amex04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107197156   Multi subunit type E3    SCF complex     Ring finger protein      107197156    Cul2 complex      107197156    Cul3 complex      107197156    Cul4 complex      107197156    Cul7 complex      107197156    Cul8 complex      107197156    Cul9 complex      107197156 DNA repair and recombination proteins [BR:amex03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107197156     TCR (transcription coupled repair) factors      Cul4-CSA complex       107197156 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  107197156 NCBI-ProteinID:  XP_022538652 Ensembl:  ENSAMXG00000030622 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggctgctatggatgtggacaccccgagcgggactaacagcggggcgagtaagaag cgcttcgaagtgaaaaagtggaatgccgttgctctctgggcctgggacatagtagtggat aactgtgccatctgcagaaatcacattatggatctctgtatagagtgccaggccaaccag gcttcagctacatcagaggagtgcactgtagcctggggagtgtgcaatcatgcttttcat ttccactgtatttcccgttggctgaagacaaggcaggtgtgccctctggataacagggag tgggagttccaaaagtatggacactga

DBGET integrated database retrieval system