KEGG   Aeropyrum pernix: APE_1586
Entry
APE_1586          CDS       T00023                                 

Symbol
cysK
Name
(GenBank) cysteine synthase
  KO
K10150  cysteine synthase / O-phosphoserine sulfhydrylase / cystathionine beta-synthase [EC:2.5.1.47 2.5.1.65 4.2.1.22]
Organism
ape  Aeropyrum pernix
Pathway
ape00260  Glycine, serine and threonine metabolism
ape00270  Cysteine and methionine metabolism
ape00920  Sulfur metabolism
ape01100  Metabolic pathways
ape01110  Biosynthesis of secondary metabolites
ape01120  Microbial metabolism in diverse environments
ape01230  Biosynthesis of amino acids
Module
ape_M00035  Methionine degradation
ape_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:ape00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    APE_1586 (cysK)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    APE_1586 (cysK)
   00270 Cysteine and methionine metabolism
    APE_1586 (cysK)
Enzymes [BR:ape01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     APE_1586 (cysK)
    2.5.1.65  O-phosphoserine sulfhydrylase
     APE_1586 (cysK)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     APE_1586 (cysK)
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: BAA80586
UniProt: Q9YBL2
Structure
LinkDB
Position
1006081..1007250
AA seq 389 aa
MALADISGYLDVLDSVRGFSYLENAREVLRSGEARCLGNPRSEPEYVKALYVIGASRIPV
GDGCSHTLEELGVFDISVPGEMVFPSPLDFFERGKPTPLVRSRLQLPNGVRVWLKLEWYN
PFSLSVKDRPAVEIISRLSRRVEKGSLVADATSSNFGVALSAVARLYGYRARVYLPGAAE
EFGKLLPRLLGAQVIVDPEAPSTVHLLPRVMKDSKNEGFVHVNQFYNDANFEAHMRGTAR
EIFVQSRRGGLALRGVAGSLGTSGHMSAAAFYLQSVDPSIRAVLVQPAQGDSIPGIRRVE
TGMLWINMLDISYTLAEVTLEEAMEAVVEVARSDGLVIGPSGGAAVKALAKKAAEGDLEP
GDYVVVVPDTGFKYLSLVQNALEGAGDSV
NT seq 1170 nt   +upstreamnt  +downstreamnt
gtggccctcgccgacataagtggttacctggacgtcctcgactcagttagggggttttcc
tatctggaaaacgcgagggaggtcctgaggagcggagaggctagatgcctaggaaacccc
cgcagcgagccggagtatgttaaggcgctctacgttataggcgcgtccagaataccggta
ggggatggttgcagccacactctagaagagctcggggtattcgatatcagcgtgcccggc
gagatggtgttcccatcgcccctagacttctttgaaagggggaagcccacccccctggtg
aggtcccgcctccagctgccaaacggcgtcagggtctggctgaagctcgaatggtacaat
cccttcagcctcagcgttaaggataggcccgcggtggaaatcatatctaggctctcgagg
agggtggagaagggctcgctggttgcagacgccacctcgtccaacttcggtgtagcactc
tcggccgtggcgaggctctacggctatagagcgcgggtctacctgcccggggctgcagag
gagttcggaaagctcctccccaggcttctaggggctcaggttattgtagaccccgaggcg
ccatcgaccgttcacctcctacccagggtgatgaaggactccaagaacgaggggttcgtt
cacgtgaaccagttctacaacgacgctaacttcgaggcccacatgagggggactgcaagg
gagatattcgtccagtcgcgcaggggagggctagcccttaggggggtcgccgggagtcta
gggacgtcgggccatatgtcggcagcggctttctaccttcagagcgtcgacccaagcatt
agagctgtgttagtgcagcccgcacagggagattccatacctggtataaggagggttgag
acgggcatgctctggataaacatgctcgacataagctataccctcgccgaggtaacgctg
gaggaggcgatggaggccgtcgtagaggtggccaggagcgacgggctagtcatcgggccc
tccggcggggcagcggtgaaggccctggctaagaaagcggcggaaggggatctggagccg
ggagactacgtggtcgtagtgccagacacggggttcaagtacctaagtctcgtgcagaat
gcgctggaaggagccggagactcggtctag

DBGET integrated database retrieval system