KEGG   Acidilobus saccharovorans: ASAC_0793
Entry
ASAC_0793         CDS       T01283                                 

Name
(GenBank) pyridoxal-5'-phosphate-dependent enzyme, beta subunit
  KO
K10150  cysteine synthase / O-phosphoserine sulfhydrylase / cystathionine beta-synthase [EC:2.5.1.47 2.5.1.65 4.2.1.22]
Organism
asc  Acidilobus saccharovorans
Pathway
asc00260  Glycine, serine and threonine metabolism
asc00270  Cysteine and methionine metabolism
asc00920  Sulfur metabolism
asc01100  Metabolic pathways
asc01110  Biosynthesis of secondary metabolites
asc01120  Microbial metabolism in diverse environments
asc01230  Biosynthesis of amino acids
Module
asc_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:asc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ASAC_0793
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASAC_0793
   00270 Cysteine and methionine metabolism
    ASAC_0793
Enzymes [BR:asc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     ASAC_0793
    2.5.1.65  O-phosphoserine sulfhydrylase
     ASAC_0793
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     ASAC_0793
SSDB
Motif
Pfam: PALP
Other DBs
NCBI-ProteinID: ADL19199
UniProt: D9Q1L1
LinkDB
Position
803791..804951
AA seq 386 aa
MRLRPLEELKAEEVSLEELLNSMRSMLRSNSVASSLAVEGDRVIDGAVDYWALRWLRCRL
APVSEGLREGGPIPLEALGFYDNAMSNEYRAYRDVMELLSNDRPTPMVMLRGDWGPGVRV
WAKLEWYNPLSLSIKDRTALGVLMEALSRNPDARKIFEVSSSNTGIALAALSAALGLRAR
IYVPTTAEGFGPSMLRILGAEVVVRGSSTVEALPSAIAEAKAEGAIMPNQFENIANPLTH
VGTTAKEIDLQANFLGLKLRGIFVTLGTRGHSAGIAFYFKNRRPDVKVFGVQPAEGSIIP
GIRRQDPSKWWPMAERPDEIIDVTDSEAMDSAIAVARTNGLLFGMSGGAAVAALLKKGKL
EEGDYVVVVPDHGIKYLDRYLSRLGD
NT seq 1161 nt   +upstreamnt  +downstreamnt
ttgaggctgaggccccttgaggagctgaaggcagaagaggtaagcttggaggagctgctg
aactccatgaggtccatgctgaggtccaactcggtggcctcctcgctcgcggtggaggga
gacagggtaattgacggcgccgtcgactactgggccctgaggtggctcaggtgcaggctg
gcccccgtcagcgagggcctaagggagggcgggcccataccgcttgaggcgctgggattc
tatgacaacgccatgtccaatgagtacagggcctacagggacgtcatggagctcctcagc
aacgaccgtccaactcccatggttatgctgaggggggactgggggccaggcgtgagggtg
tgggccaagcttgagtggtacaaccctctcagcctgagcataaaggacaggacggccctc
ggggtgctgatggaggccctatcaaggaatcccgacgccaggaaaatctttgaggtgtcc
tcctctaacaccggcatagcactcgccgccctctcagccgccctgggcctgagggccagg
atatacgtgccgaccactgctgagggcttcggcccctccatgcttaggatcctcggggcc
gaggtcgtggtgaggggctcatcgacagtcgaggcccttccgtcagccattgcggaggcc
aaggccgagggcgccataatgcccaaccagtttgaaaacattgccaacccgctcacgcac
gtggggacgacggccaaggagatagacctccaggcgaacttcctgggcctcaagctcagg
ggcatattcgtgacgcttggcacccgcggccactccgctggcatagcgttttacttcaag
aacaggaggcctgacgtcaaggtcttcggcgtgcagccggccgagggaagcataataccc
ggcatcaggaggcaggacccctcaaagtggtggcccatggctgagaggcccgatgaaatc
atcgacgtcacggactccgaggccatggactccgcgatagctgttgccaggaccaacggc
ctcctgtttgggatgagcgggggcgcggccgtggcggccctgctcaagaagggcaagctg
gaggagggggactacgtagtagtggttcctgaccacggcattaagtacttagatcgctac
ctctcaaggctgggggactaa

DBGET integrated database retrieval system