KEGG   Acetobacter oryzifermentans: WG31_09955
Entry
WG31_09955        CDS       T04478                                 
Name
(GenBank) aromatic ring-opening dioxygenase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
asv  Acetobacter oryzifermentans
Pathway
asv03030  DNA replication
asv03410  Base excision repair
asv03420  Nucleotide excision repair
asv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:asv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    WG31_09955
   03410 Base excision repair
    WG31_09955
   03420 Nucleotide excision repair
    WG31_09955
   03430 Mismatch repair
    WG31_09955
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:asv03032]
    WG31_09955
   03400 DNA repair and recombination proteins [BR:asv03400]
    WG31_09955
Enzymes [BR:asv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     WG31_09955
DNA replication proteins [BR:asv03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     WG31_09955
DNA repair and recombination proteins [BR:asv03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     WG31_09955
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     WG31_09955
   MMR (mismatch excision repair)
    DNA ligase
     WG31_09955
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      WG31_09955
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB BRCT DNA_ligase_ZBD HHH_2 PTCB-BRCT Nlig-Ia HHH_5 RUBY_RBDX
Other DBs
NCBI-ProteinID: ANA14278
UniProt: A0ABM6AKT5
LinkDB
Position
2102247..2104334
AA seq 695 aa
MPEPAFLPATMTLQQAREELEHLAAEIAHHNVAYDQHNAPEISDAEYDALRRRYDAIVAQ
HPQAEPENSAAQAVGAAPDTAFGKHIHLVPMLSLDNVFDREDFEGFISRASRFLGLDQEA
TEQLIFVGEPKIDGLSISLTYEKGRFVRGTTRGDGTEGEDVTANLRTLKDLPLRLSGSYP
DLIEIRGEVFLSKKHFLELNAAQEAANKQLFANPRNAAAGSLRQLDSKITAQRPLSLFAY
ALGFCSEKISRSHWAYLEQLKAWGFPVNPLSRQIKGVEDAEVFFAEVSQNRAELAYDIDG
VVYKIDDLALQERLGFAGRAPRWAIAWKFPAEQAVTRLKEIEIQVGRTGALTPVAHLEPV
NVGGVLVMRATLHNEDEIARKDVRPGDMVFIQRAGDVIPQVLGVAPSTDSTPRQAPYQFP
DRCPACGAAAVRPEGEAVRRCTGGLTCPAQVVERLIHFVSRQAFDIEGLGDRSIREFHDI
GLILTPGDIFRLHEHAADIEKRDGWGEQSVQKLLQAIESRRTISLSRFIYALGIRRIGAS
NARLLARHYGTYENWFNQMQAAAIIGSDARLELGSITGIGTTTAEDLVAFVAEEHNLQTL
ADLRANLTITEETAASEGALAGKTIVFTGTLHTMTRPEAKATAERMGAKVSDSVSKKTDL
VVLGEKAGSKAKKAVELGLQTMDEAEWNAFCSEQE
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgcctgaacccgcctttcttcccgctacaatgacactccaacaagcacgggaagaactg
gagcaccttgctgccgaaattgcccaccataatgtggcttacgatcagcacaatgcgcca
gaaatcagtgatgcagaatatgatgccctgcgcaggcggtatgatgccattgtggctcag
cacccacaggccgaaccagaaaacagcgcagcccaagccgtaggggccgcacccgataca
gcttttggcaagcacatccaccttgtgcccatgctctcgctggacaacgtgtttgaccgg
gaagattttgaaggcttcatcagccgcgcctcacgctttttagggctggatcaggaagcg
acagaacaactgatttttgtaggggagcccaaaattgatggcctttccatcagcctaacc
tacgaaaaaggccgttttgtacgtggcaccacccgcggagatggcactgaaggcgaagac
gttaccgccaatttgcgcacgcttaaggatttgccgttacgcctttctggctcctacccc
gatctcatcgaaattcgtggtgaggtttttctttccaaaaagcactttctggaactcaac
gcagcgcaagaagctgcaaacaaacagctgtttgccaacccgcgtaatgcagcagcgggt
tcattacggcagctagattccaaaattacggcacaacgcccgctgtccttattcgcttat
gcgcttggtttctgctcagaaaaaatcagccgcagccattgggcttatctggagcaactc
aaagcatggggttttccggttaatccgctttctcgccagattaaaggcgtagaagatgcc
gaagtcttttttgcggaagtcagccagaatcgggctgaacttgcctacgatattgatggc
gttgtttacaaaattgatgatctggccctgcaagaacgcttaggttttgcaggccgcgcc
ccgcgctgggccattgcgtggaagtttccggcggaacaggcggttacccgcctgaaagaa
atagaaattcaggttggacgcacaggtgcgcttacccctgttgcacatctggagccggta
aatgttggtggtgtgctggttatgcgcgcaaccttgcataatgaagatgaaattgcccgc
aaggatgtccgccccggtgatatggtttttatccagcgggcgggagatgttatccctcaa
gtgttgggcgttgccccttctacagatagcacgccccggcaggccccttatcagttcccc
gatcgttgccctgcttgcggtgcggcggcggtgcggccagaaggcgaagctgtgcgccgt
tgcacaggtgggctcacctgccccgcgcaggttgtggagcggctgatccactttgtttcc
cgccaagcgtttgacattgaaggcttgggagaccgcagtattcgtgaattccacgatatc
ggcctgattttaacacctggtgatattttccgtctgcatgaacacgccgcagatatagaa
aagcgcgatggttggggcgagcaatctgttcagaagctgttgcaggccatagagagccgc
cgcaccatttctctttctcgttttatttatgcgcttggcatccgtcggattggcgccagc
aatgcccgcctgctggcacgccactatggcacctatgaaaactggtttaaccagatgcag
gctgccgccattattggatctgacgcacggctggaactgggttccattaccggtataggc
acgaccacagcggaagatctggtggcctttgtggcagaagaacataatctgcaaacattg
gcggatttacgcgcaaatctgaccataacggaagaaaccgcagcatccgaaggtgccttg
gctggcaaaaccattgtgtttaccggcaccctacacaccatgacacggccagaagccaaa
gcaacggcagaacgcatgggcgctaaggtttcggattctgtttccaaaaaaacagatctg
gttgttctgggggaaaaagctggctcaaaggccaaaaaggctgtggaacttggccttcaa
accatggatgaagcagaatggaacgctttttgttccgagcaggaatag

DBGET integrated database retrieval system