KEGG   Bos indicus (zebu cattle): 109556903
Entry
109556903         CDS       T04792                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00250  Alanine, aspartate and glutamate metabolism
biu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109556903 (RIMKLA)
Enzymes [BR:biu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     109556903 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     109556903 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Synapsin_C TTL
Other DBs
NCBI-GeneID: 109556903
NCBI-ProteinID: XP_019813833
UniProt: A0A6P5B5T3
LinkDB
Position
3:complement(110713243..110729683)
AA seq 340 aa
MEGGLQLNQKALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINK
FWTFQELAGHGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKGVFLARDKH
HLSDICHLIRHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGV
GVMCPLTEQGKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDV
GGIIADYTMSLLPNRQTGKMAVLPGLASPREKKEPDGCASAQGVAESVYAINSGSTSSES
EPELGEIRASSASTAGAPAPXLPDPSYNINTRIASELKLK
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggaaggaggcctgcagctgaaccagaaggcgctcaccactttcccagacgtggtgctt
gtccgcgtgcccacgccctccgtgcagtcggacagtgacatcaccgtcctgcgacacctg
gagaagctgggctgccgcttagtcaaccgcccacagagcattctaaactgcatcaacaaa
ttctggacattccaggagctggctgggcatggggtccccatgccagacaccttctcctat
ggtggacatgaagacttttcgaaaatgatcgatgaagccgagccgctgggttaccccgtg
gtggtgaagagcacgcgcggacaccggggaaaaggtgtttttcttgcaagagataaacac
cacctctcagacatctgccacctgatccgccacgacgtgccctacctgttccagaagtac
gtgaaggagtcccacggaaaagatatccgggtggtggtggtcggcggccaggtgataggc
tccatgcttcgctgctccacagatggacggatgcagagcaactgctctctcggtggcgtg
ggcgtcatgtgcccgctgacggaacaaggcaagcagctggctatccaggtgtctaacatc
ctgggcatggacttctgtggcatcgatcttctcatcatggacgatggctccttcgtggtg
tgtgaggcaaatgccaacgtgggcttcctagccttcgaccaggcatgcaacttagacgtg
ggcgggatcattgcagactacaccatgtccttgctgcccaacaggcagaccgggaagatg
gcygtcctcccaggcttggctagccccagggagaagaaagagccagatggctgtgcttca
gctcagggagttgcagagagcgtctatgccatcaacagcgggtctacctccagcgagagt
gagcctgaactgggagagatccgggcttcctcagccagcacagcgggggccccggccccc
mtgctgcctgaccccagctacaacattaacaccaggattgcttcagaattaaaacttaag
tga

DBGET integrated database retrieval system