KEGG   Camelus bactrianus (Bactrian camel): 105072857
Entry
105072857         CDS       T07534                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
cbai  Camelus bactrianus (Bactrian camel)
Pathway
cbai00250  Alanine, aspartate and glutamate metabolism
cbai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105072857 (RIMKLA)
Enzymes [BR:cbai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     105072857 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     105072857 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C CPSase_L_D2 ATP-grasp Synapsin_C TTL
Other DBs
NCBI-GeneID: 105072857
NCBI-ProteinID: XP_010958245
LinkDB
Position
Unknown
AA seq 356 aa
MESGSPKGNVGAELGKDCVGLQLNQKALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLG
CRLVNRPQSILNCINKFWTFQELAGHGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKS
TRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYVKESHGKDIRVVVVGGRVIGSMLR
CSTDGRMQSNCSLGGVGVMCPLTEQGKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEAN
ANVGFLAFDQACNLDVGGIIADYTMSLLPTRQTGKMAVLPGLSSPREKKEPDGCASAQGV
AESVYAINSGSTSSESEPELGELRDSSASTTGAPAPMLPDPGYNINNRIASELRLK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggaaagtggaagtccaaaaggcaatgttggagccgagttggggaaagactgtgtcggt
ttgcagctgaaccagaaggcgctcaccaccttcccagacgtggtgcttgtcagggtgccc
acaccctctgtgcaatcggatagtgacatcacagtcctgagacacctggagaagttgggc
tgccgcttagtcaaccgcccacagagcattttaaactgtatcaacaaattctggacgttc
caggagctggctggacatggggtccccatgccagataccttctcctacggtgggcatgaa
gacttttccaaaatgatcgatgaagccgagccgctgggctacccggtggtggtgaaaagc
acgcgcggacaccggggaaaagctgtttttctcgcaagagataaacaccacctctcagat
atctgccatctgatccgccacgacgtgccctacctgttccagaagtacgtgaaggagtcc
catggaaaggatatccgggtggtggttgttgggggccgggtgataggctccatgcttcgc
tgctccacagacggacggatgcagagcaattgctctctcggtggcgtgggtgtcatgtgc
ccgctgacagaacaaggcaagcagttggctatccaggtgtccaacatcctgggcatggac
ttctgtggcatcgatctcctcatcatggacgatggctcctttgtggtgtgcgaggcaaac
gccaacgtcggtttcctagccttcgaccaggcgtgcaacttagacgtgggtgggatcatt
gcggactacaccatgtccttgctgcccaccaggcagactgggaagatggccgtcctccca
ggactgtctagtcccagagagaagaaggagccagatggctgtgcttcagctcagggagta
gcagagagcgtctacgccatcaacagtgggtctacctccagcgagagtgagcctgaactg
ggagagctccgggattcctcagcgagcacgacgggggccccggcccccatgctgcccgac
cccggctacaacattaacaacaggattgcttccgagttaagactaaagtga

DBGET integrated database retrieval system