Castor canadensis (American beaver): 109678454 Help Entry 109678454         CDS       T04791                                  Name (RefSeq) caspase-3-like   KO K02187   caspase 3 [EC:3.4.22.56] Organism ccan  Castor canadensis (American beaver) Pathway ccan01524   Platinum drug resistance ccan04010   MAPK signaling pathway ccan04115   p53 signaling pathway ccan04148   Efferocytosis ccan04210   Apoptosis ccan04215   Apoptosis - multiple species ccan04623   Cytosolic DNA-sensing pathway ccan04650   Natural killer cell mediated cytotoxicity ccan04657   IL-17 signaling pathway ccan04668   TNF signaling pathway ccan04726   Serotonergic synapse ccan04932   Non-alcoholic fatty liver disease ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan04936   Alcoholic liver disease ccan05010   Alzheimer disease ccan05012   Parkinson disease ccan05014   Amyotrophic lateral sclerosis ccan05016   Huntington disease ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05132   Salmonella infection ccan05133   Pertussis ccan05134   Legionellosis ccan05145   Toxoplasmosis ccan05146   Amoebiasis ccan05152   Tuberculosis ccan05160   Hepatitis C ccan05161   Hepatitis B ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05165   Human papillomavirus infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05168   Herpes simplex virus 1 infection ccan05169   Epstein-Barr virus infection ccan05170   Human immunodeficiency virus 1 infection ccan05200   Pathways in cancer ccan05203   Viral carcinogenesis ccan05205   Proteoglycans in cancer ccan05206   MicroRNAs in cancer ccan05210   Colorectal cancer ccan05222   Small cell lung cancer ccan05416   Viral myocarditis ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109678454    04668 TNF signaling pathway     109678454  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     109678454   09143 Cell growth and death    04210 Apoptosis     109678454    04215 Apoptosis - multiple species     109678454    04115 p53 signaling pathway     109678454  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     109678454    04650 Natural killer cell mediated cytotoxicity     109678454    04657 IL-17 signaling pathway     109678454   09156 Nervous system    04726 Serotonergic synapse     109678454  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109678454    05206 MicroRNAs in cancer     109678454    05205 Proteoglycans in cancer     109678454    05203 Viral carcinogenesis     109678454   09162 Cancer: specific types    05210 Colorectal cancer     109678454    05222 Small cell lung cancer     109678454   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109678454    05161 Hepatitis B     109678454    05160 Hepatitis C     109678454    05164 Influenza A     109678454    05162 Measles     109678454    05168 Herpes simplex virus 1 infection     109678454    05163 Human cytomegalovirus infection     109678454    05167 Kaposi sarcoma-associated herpesvirus infection     109678454    05169 Epstein-Barr virus infection     109678454    05165 Human papillomavirus infection     109678454   09171 Infectious disease: bacterial    05132 Salmonella infection     109678454    05133 Pertussis     109678454    05134 Legionellosis     109678454    05152 Tuberculosis     109678454   09174 Infectious disease: parasitic    05146 Amoebiasis     109678454    05145 Toxoplasmosis     109678454   09164 Neurodegenerative disease    05010 Alzheimer disease     109678454    05012 Parkinson disease     109678454    05014 Amyotrophic lateral sclerosis     109678454    05016 Huntington disease     109678454    05020 Prion disease     109678454    05022 Pathways of neurodegeneration - multiple diseases     109678454   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109678454    05416 Viral myocarditis     109678454   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     109678454    04932 Non-alcoholic fatty liver disease     109678454    04933 AGE-RAGE signaling pathway in diabetic complications     109678454   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     109678454  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ccan01002]     109678454 Enzymes [BR:ccan01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      109678454 Peptidases and inhibitors [BR:ccan01002]  Cysteine peptidases   Family C14: caspase family    109678454 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  109678454 NCBI-ProteinID:  XP_020009589 UniProt:  A0A8B7TPE3 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MEISENSVDSKSIKNFETKIIHGSKSMDSGISLDSSYKMDYPEMGVCVIINNKNFHKSTG MAARSGTDVDAANLRETFMGLKYEVRNKNDLTREEIVELLHNVSKEDHSKRSSFICVILS HGEEGVIYGTNGPVNLKKLTSFFRGDYCRTLTGKPKLFIIQACRGTELDCGIETDSGIDD DMACQKIPVEADFLYAYSTAPGKKFTNNECYIEIF NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggaaatcagtgaaaactcagtggattcaaaatccattaaaaatttcgaaacgaagatt atacatgggagtaaatcaatggactctgggatatccttggacagtagttacaaaatggat tatcctgaaatgggcgtatgcgtgataatcaataataagaactttcataagagcactggg atggctgcccggtctgggacagatgtagatgcagcaaacctcagagaaacattcatgggc ttaaaatacgaagttaggaataaaaatgatcttacacgtgaagaaattgtggaattgctg cacaatgtttctaaagaagatcatagcaaaagaagcagttttatttgcgtaattctaagc catggtgaagaaggagtaatttatggaacaaatggacctgttaacctgaaaaaattgaca agtttcttcagaggagattactgcagaactctcacaggaaaacccaaacttttcattatt caggcctgccgggggacagaactggactgtggcattgagacagacagtggcattgacgat gacatggcgtgccagaaaataccagtagaggccgacttcttgtacgcatattccacagca cctggtaagaaatttacaaataatgaatgttatatcgaaattttttag

DBGET integrated database retrieval system