KEGG   Castor canadensis (American beaver): 109702396
Entry
109702396         CDS       T04791                                 
Symbol
Rimkla
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00250  Alanine, aspartate and glutamate metabolism
ccan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109702396 (Rimkla)
Enzymes [BR:ccan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     109702396 (Rimkla)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     109702396 (Rimkla)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Synapsin_C TTL
Other DBs
NCBI-GeneID: 109702396
NCBI-ProteinID: XP_020043337
UniProt: A0A8B7WI85
LinkDB
Position
Unknown
AA seq 325 aa
LQLNQKALTTFPDVVVVRVSTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTF
QELAGHGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSD
ICHLVRHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVKC
PLTEQGKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGAII
ADYTMSLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINNGSTSSESEPEL
GEVRDSSANTMGVPSPHATRAWLQH
NT seq 980 nt   +upstreamnt  +downstreamnt
gcctgcagctgaaccagaaggccctcaccaccttcccagatgtggtggttgtgcgagtgt
ctacaccctctgtgcagtcagacagcgacatcaccgtcctgaggcacctggagaagcttg
gctgccgcttagtcaaccgcccacagagcatcttaaactgcatcaacaaattctggacat
ttcaagagctggctggacatggggtccccatgccagataccttctcctatggtgggcatg
aagacttttcaaaaatgattgatgaagctgagcccctgggctacccagtcgtggtgaaga
gcacacgaggccaccggggaaaagctgtttttctggcaagagataagcatcacctgtcag
acatctgccatctggtccgccatgacgtgccctacctgtttcagaagtacgtaaaggagt
cacatggaaaagacatccgagtggtggtggtagggggccaggtgataggctccatgcttc
gctgctccacagatggacggatgcagagcaactgctctcttggtggtgtgggtgtcaagt
gcccattgacagaacaaggcaagcagctggccattcaggtgtcgaacatcctgggcatgg
acttctgcggcattgatcttctcattatggatgatggctcctttgtggtgtgtgaggcaa
atgccaatgtcggcttcctggccttcgaccaggcgtgcaacttagatgtgggggcgatca
ttgcagactataccatgtccttactgccaaataggcagactgggaagatggccgtcctcc
caggactgtcgagtcccagggagaagaatgagccagatggctgtgcatcagctcagggag
ttgcagagagtgtctacaccatcaacaacgggtctacctctagtgagagtgaacctgaac
tgggagaggtccgggattcctcagcaaacacaatgggggttccatccccccatgctaccc
gagcctggctacaacattaa

DBGET integrated database retrieval system