KEGG   Camelus dromedarius (Arabian camel): 105105491
Entry
105105491         CDS       T04642                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X1
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
cdk  Camelus dromedarius (Arabian camel)
Pathway
cdk00250  Alanine, aspartate and glutamate metabolism
cdk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cdk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105105491 (RIMKLA)
Enzymes [BR:cdk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     105105491 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     105105491 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C CPSase_L_D2 ATP-grasp Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 105105491
NCBI-ProteinID: XP_010997582
UniProt: A0A5N4DA51
LinkDB
Position
13:31867171..31898139
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVSFRAVLMDQIAVTIVGGNLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGRVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPTRQTGKMAVLPGLSSPREKKEPDGCASAQGVAESVYAINSGSTSSESEPELGELRD
SSASTTGAPAPMLPDPGYNINNRIASELRLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgagcttccgggcggtg
ctcatggaccagatcgccgtcaccatcgtcggcggcaacctcggtttgcagctgaaccag
aaggcgctcaccaccttcccagacgtggtgcttgtcagggtgcccacaccctctgtgcaa
tcggatagtgacatcacagtcctgagacacctggagaagttgggctgccgcttagtcaac
cgcccacagagcattttaaactgcatcaacaaattctggacgttccaggagctggctgga
catggggtccccatgccagataccttctcctacggtgggcatgaagacttttccaaaatg
atcgatgaagccgagccgctgggctacccggtggtggtgaaaagcacacgcggacaccgg
ggaaaagctgtttttctcgcaagagataaacaccacctctcagatatctgccatctgatc
cgccacgacgtgccctacctgttccagaagtacgtgaaggagtcccatggaaaggatatc
cgggtggtggttgttgggggccgggtgataggctccatgcttcgctgctccacagacgga
cggatgcagagcaattgctctctcggtggcgtgggtgtcatgtgcccgctgacagaacaa
ggcaagcagttggctatccaggtgtccaacatcctgggcatggacttctgtggcatcgat
ctcctcatcatggacgatggctcctttgtggtgtgcgaggcaaatgccaacgtcggtttc
ctagccttcgaccaggcgtgcaacttagacgtgggtgggatcattgcggactacaccatg
tccttgctgcccaccaggcagactgggaagatggccgtcctcccaggactgtctagtccc
agagagaagaaggagccagatggctgtgcttcagctcagggagtagcagagagcgtctac
gccatcaacagtgggtctacctccagcgagagtgagcctgaactgggagagctccgggat
tcctcagcgagcacgacgggggccccggcccccatgctgcccgaccccggctacaacatt
aacaacaggattgcttccgagttaagactaaagtga

DBGET integrated database retrieval system