KEGG   Canis lupus familiaris (dog): 482445
Entry
482445            CDS       T01007                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X2
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00250  Alanine, aspartate and glutamate metabolism
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    482445 (RIMKLA)
Enzymes [BR:cfa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     482445 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     482445 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 Dala_Dala_lig_C ATP-grasp CPSase_L_D2 Synapsin_C TTL
Other DBs
NCBI-GeneID: 482445
NCBI-ProteinID: XP_038307718
Ensembl: ENSCAFG00000002557
VGNC: 45580
LinkDB
Position
15:complement(1108525..1143813)
AA seq 362 aa
MGFPLNSSPRPPKVSNADSRKAKISGLQLNQKALTTFPDVVLVRVPTPSVQSDSDITVLR
HLEKLGCRLVNRPQSILNCVNKFWTFQELAGHGVPMPDTFSYGGHEDFSKMIDEAEPLGY
PVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYVKESHGKDIRVVVVGGRV
IGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQGKQLAIQVSNILGMDFCGIDLLIMDDGSF
VVCEANANVGFLAFDQACNLDVGGIIADYTMSLLPNRQTGKMAVLPGLSSPREKKEPDGC
ASAQGVAESVYAINNGSTSSESEPELGEIRDSSVSTTGASPPMLPDPGYNINNRIASELK
LK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgggttttcctttaaactcatccccccgccccccgaaagtgtccaatgctgattccaga
aaagccaagatttcaggccttcagctgaaccagaaggcgctcaccactttcccagatgtg
gtgctcgtgcgggtgcccacgccctccgtgcagtcagacagcgacatcacggtcctgcgc
cacctggagaagctgggctgccgcctggtcaaccgcccacagagcatcttaaactgcgtc
aacaagttctggactttccaagagctggctggacatggggttcccatgccagacaccttc
tcctatggtggccatgaagacttttcaaaaatgattgacgaagccgagcccctgggctac
ccggtcgtggtgaagagcacgcgaggacaccggggaaaagctgtttttctcgcaagagat
aaacatcacctctcagacatctgccatctgatccgccatgatgtgccctacctgttccag
aaatatgtgaaggagtcacatggcaaagatatccgggtggtggtggtagggggccgggtg
ataggctcaatgcttcgctgctccacagatggacggatgcagagcaactgctctctcggt
ggtgtgggcgtcatgtgcccactgacagaacaaggcaagcagttggctattcaggtatct
aacatcctgggcatggacttctgcggcatcgatctgctcattatggacgacggctccttt
gtggtgtgcgaggcaaacgccaacgtcggcttcctagccttcgaccaggcgtgtaattta
gacgtgggtggcatcatcgcggactacaccatgtccttgctgcccaataggcagactggc
aagatggctgtgctcccaggactgtccagtcccagggagaagaaagagccagatggctgc
gcttcagctcagggagtcgcagagagcgtctatgccatcaacaatgggtctacctctagt
gagagtgagcctgaactgggagagatccgggattcctcagtgagcaccacgggggcctcg
ccccccatgctgcccgaccccggctacaacattaacaacaggattgcttcagaattaaaa
cttaagtga

DBGET integrated database retrieval system