Camelus ferus (Wild Bactrian camel): 102520133 Help Entry 102520133         CDS       T02979                                  Symbol CASP3 Name (RefSeq) caspase-3   KO K02187   caspase 3 [EC:3.4.22.56] Organism cfr  Camelus ferus (Wild Bactrian camel) Pathway cfr01524   Platinum drug resistance cfr04010   MAPK signaling pathway cfr04115   p53 signaling pathway cfr04148   Efferocytosis cfr04210   Apoptosis cfr04215   Apoptosis - multiple species cfr04623   Cytosolic DNA-sensing pathway cfr04650   Natural killer cell mediated cytotoxicity cfr04657   IL-17 signaling pathway cfr04668   TNF signaling pathway cfr04726   Serotonergic synapse cfr04932   Non-alcoholic fatty liver disease cfr04933   AGE-RAGE signaling pathway in diabetic complications cfr04936   Alcoholic liver disease cfr05010   Alzheimer disease cfr05012   Parkinson disease cfr05014   Amyotrophic lateral sclerosis cfr05016   Huntington disease cfr05020   Prion disease cfr05022   Pathways of neurodegeneration - multiple diseases cfr05132   Salmonella infection cfr05133   Pertussis cfr05134   Legionellosis cfr05145   Toxoplasmosis cfr05146   Amoebiasis cfr05152   Tuberculosis cfr05160   Hepatitis C cfr05161   Hepatitis B cfr05162   Measles cfr05163   Human cytomegalovirus infection cfr05164   Influenza A cfr05165   Human papillomavirus infection cfr05167   Kaposi sarcoma-associated herpesvirus infection cfr05168   Herpes simplex virus 1 infection cfr05169   Epstein-Barr virus infection cfr05170   Human immunodeficiency virus 1 infection cfr05200   Pathways in cancer cfr05203   Viral carcinogenesis cfr05205   Proteoglycans in cancer cfr05206   MicroRNAs in cancer cfr05210   Colorectal cancer cfr05222   Small cell lung cancer cfr05416   Viral myocarditis cfr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102520133 (CASP3)    04668 TNF signaling pathway     102520133 (CASP3)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     102520133 (CASP3)   09143 Cell growth and death    04210 Apoptosis     102520133 (CASP3)    04215 Apoptosis - multiple species     102520133 (CASP3)    04115 p53 signaling pathway     102520133 (CASP3)  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     102520133 (CASP3)    04650 Natural killer cell mediated cytotoxicity     102520133 (CASP3)    04657 IL-17 signaling pathway     102520133 (CASP3)   09156 Nervous system    04726 Serotonergic synapse     102520133 (CASP3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102520133 (CASP3)    05206 MicroRNAs in cancer     102520133 (CASP3)    05205 Proteoglycans in cancer     102520133 (CASP3)    05203 Viral carcinogenesis     102520133 (CASP3)   09162 Cancer: specific types    05210 Colorectal cancer     102520133 (CASP3)    05222 Small cell lung cancer     102520133 (CASP3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102520133 (CASP3)    05161 Hepatitis B     102520133 (CASP3)    05160 Hepatitis C     102520133 (CASP3)    05164 Influenza A     102520133 (CASP3)    05162 Measles     102520133 (CASP3)    05168 Herpes simplex virus 1 infection     102520133 (CASP3)    05163 Human cytomegalovirus infection     102520133 (CASP3)    05167 Kaposi sarcoma-associated herpesvirus infection     102520133 (CASP3)    05169 Epstein-Barr virus infection     102520133 (CASP3)    05165 Human papillomavirus infection     102520133 (CASP3)   09171 Infectious disease: bacterial    05132 Salmonella infection     102520133 (CASP3)    05133 Pertussis     102520133 (CASP3)    05134 Legionellosis     102520133 (CASP3)    05152 Tuberculosis     102520133 (CASP3)   09174 Infectious disease: parasitic    05146 Amoebiasis     102520133 (CASP3)    05145 Toxoplasmosis     102520133 (CASP3)   09164 Neurodegenerative disease    05010 Alzheimer disease     102520133 (CASP3)    05012 Parkinson disease     102520133 (CASP3)    05014 Amyotrophic lateral sclerosis     102520133 (CASP3)    05016 Huntington disease     102520133 (CASP3)    05020 Prion disease     102520133 (CASP3)    05022 Pathways of neurodegeneration - multiple diseases     102520133 (CASP3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102520133 (CASP3)    05416 Viral myocarditis     102520133 (CASP3)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102520133 (CASP3)    04932 Non-alcoholic fatty liver disease     102520133 (CASP3)    04933 AGE-RAGE signaling pathway in diabetic complications     102520133 (CASP3)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102520133 (CASP3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:cfr01002]     102520133 (CASP3) Enzymes [BR:cfr01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      102520133 (CASP3) Peptidases and inhibitors [BR:cfr01002]  Cysteine peptidases   Family C14: caspase family    102520133 (CASP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_C14 SICA_beta Motif Other DBs NCBI-GeneID:  102520133 NCBI-ProteinID:  XP_032324303 UniProt:  A0A8B8S264 LinkDB All DBs Position 26:17949426..17964311 Genome browser AA seq 275 aa AA seqDB search MENTENSVDSKSIKTLETNIFHGSKSMDSGLSLDNSYKMDYPEMGLCLIINIKNFHKSTG MACRSGTDVDAANLRETFTNLKYEVRNKNDLTCEEILKLMYNVSKEDHSKRSSFICVLLS HGEEGVIYGTDGAVDLKKLTSFFRGDSCRSLTGKPKLFIIQACRGTELDCGIETDSGVED EMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYAHKLELMHILTRVN RKVAIEFESFSIDSAFHAKKQIPCIVSMLTKELYF NT seq 828 nt NT seq  +upstreamnt  +downstreamnt atggagaacactgaaaactcagtggattcaaaatccattaaaaccttggagacaaatatc ttccatggaagcaaatcaatggactctggactatccttagacaacagttataaaatggat tatcctgaaatgggtttatgtttaataattaatattaagaactttcataaaagtactgga atggcatgtcggtctggtacagatgtagatgcagcaaacctcagggaaaccttcacgaac ttgaaatacgaagtcagaaataaaaatgatcttacatgtgaagaaattttgaaattaatg tacaatgtttctaaagaagatcatagcaaaaggagcagtttcatttgtgtgcttctaagc catggtgaagaaggagtgatttatggaacagatggggctgttgatctgaaaaaattaaca agcttcttcagaggggacagttgtagaagcctaaccggaaaacccaaacttttcattatt caggcctgccgaggcacagagctggactgtgggattgagacagacagtggcgttgaggac gaaatggcctgtcagaaaatacccgttgaggccgacttcttgtatgcatactccacggca cctggttactattcctggagaaattcaaaggatggatcctggttcatccagtccctttgt gcaatgctgaagcagtacgctcacaaactcgagctgatgcacattcttactcgggttaac cgaaaggtggcaatagaattcgagtctttttccattgactctgcttttcatgcaaagaaa cagattccatgtattgtgtccatgctcacaaaagaactatatttttaa

DBGET integrated database retrieval system