Danio rerio (zebrafish): 449846 Help Entry 449846            CDS       T01004                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism dre  Danio rerio (zebrafish) Pathway dre03420   Nucleotide excision repair dre04110   Cell cycle dre04114   Oocyte meiosis dre04120   Ubiquitin mediated proteolysis dre04141   Protein processing in endoplasmic reticulum dre04310   Wnt signaling pathway dre04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:dre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     449846 (rbx1)    04120 Ubiquitin mediated proteolysis     449846 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     449846 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     449846 (rbx1)    04350 TGF-beta signaling pathway     449846 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:dre04121]     449846 (rbx1)    03400 DNA repair and recombination proteins [BR:dre03400]     449846 (rbx1) Enzymes [BR:dre01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      449846 (rbx1) Ubiquitin system [BR:dre04121]  Ubiquitin ligases (E3)   UBL E3 ligases    449846 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      449846 (rbx1)    Cul2 complex      449846 (rbx1)    Cul3 complex      449846 (rbx1)    Cul4 complex      449846 (rbx1)    Cul7 complex      449846 (rbx1)    Cul8 complex      449846 (rbx1)    Cul9 complex      449846 (rbx1) DNA repair and recombination proteins [BR:dre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       449846 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       449846 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  449846 NCBI-ProteinID:  NP_001077013 ZFIN:  ZDB-GENE-041008-106 Ensembl:  ENSDARG00000038030 UniProt:  A4FUL3 LinkDB All DBs Position 3:complement(25101960..25107802) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGANSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtggacaccccaagtggagctaacagcggagccagtaaaaag cgatttgaagtgaaaaagtggaacgctgtggctctgtgggcatgggacattgtagtggac aactgtgccatctgcagaaatcacattatggacctctgtattgagtgtcaggccaatcag gcgtctgccacctcagaggagtgtacggtggcctggggagtctgcaatcacgcttttcat ttccactgcatctcccgctggctgaagaccagacaagtgtgtccactggacaacagagag tgggagtttcagaagtatggtcattag

DBGET integrated database retrieval system