Danio rerio (zebrafish): 556424 Help Entry 556424            CDS       T01004                                  Symbol rhoga Name (RefSeq) ras homolog family member Ga   KO K07863   Ras homolog gene family, member G Organism dre  Danio rerio (zebrafish) Pathway dre05100   Bacterial invasion of epithelial cells dre05132   Salmonella infection Brite KEGG Orthology (KO) [BR:dre00001]  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     556424 (rhoga)    05100 Bacterial invasion of epithelial cells     556424 (rhoga)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dre04147]     556424 (rhoga)    04031 GTP-binding proteins [BR:dre04031]     556424 (rhoga) Exosome [BR:dre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    556424 (rhoga)   Exosomal proteins of other body fluids (saliva and urine)    556424 (rhoga)   Exosomal proteins of colorectal cancer cells    556424 (rhoga)   Exosomal proteins of bladder cancer cells    556424 (rhoga) GTP-binding proteins [BR:dre04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     556424 (rhoga) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU DUF498 DAP3 Gtr1_RagA Motif Other DBs NCBI-GeneID:  556424 NCBI-ProteinID:  NP_001076273 ZFIN:  ZDB-GENE-060503-820 Ensembl:  ENSDARG00000068653 UniProt:  Q1LY89 LinkDB All DBs Position 15:complement(40909534..40926524) Genome browser AA seq 191 aa AA seqDB search MQNIKCVVVGDGAVGKTCLLISFTTNAFPKEYVPTVFDNYSAQVLVDSKTVSLNLWDTAG QEEYDRLRTLSYPQTNIFIICFSVTSPPSFENVKLKWHPEVFEHCPNVPILLVGTKKDLR DDPEELKKLKEKGLSVVSQQQGTALARQIHARKYMECSALSQDGVKEVFTEAARIFLHPK QPSSKKSCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaacatcaagtgtgtggtggtgggagacggagctgtgggaaaaacctgcctgctg atttccttcaccacaaacgcctttcccaaagaatacgttcccactgtgtttgacaattac agcgcacaagtgctcgtggactcaaaaactgtcagtctgaacctgtgggatacagcagga caggaggagtacgaccgtttgcgtactctttcttacccacagaccaacatcttcatcatc tgtttcagcgtcaccagtcctccatcttttgagaacgtcaagctgaagtggcaccccgag gtgtttgaacactgcccgaatgtgcccatccttctagtgggcactaagaaggacctgagg gacgatccggaggagctgaagaagctgaaggagaagggtctgtcggtggtgtcccagcag caggggacggcgctggctagacaaatacatgcccggaaatacatggagtgttcagcgctc agccaggacggggtgaaagaggtcttcacagaagcggcgcggattttccttcatcccaaa caaccgtcctccaagaaatcatgtgtgctgctgtaa

DBGET integrated database retrieval system