KEGG   Equus asinus (ass): 106847814
Entry
106847814         CDS       T04645                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A isoform X1
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
eai  Equus asinus (ass)
Pathway
eai00250  Alanine, aspartate and glutamate metabolism
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106847814 (RIMKLA)
Enzymes [BR:eai01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     106847814 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     106847814 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 106847814
NCBI-ProteinID: XP_014722813
LinkDB
Position
5:34369170..34414116
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTVVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHQGKAVFLARDKHHISDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKKEPDGCASAQGVAENVYTINSGSTSSESEPELAEIRD
SSASTTGAPPPMLPEPGYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccgtcgtcggcggccacctcggcctacagctgaaccag
aaggcactcaccaccttcccagacgtggtgctcgtccgggtgcccacaccctcagtgcag
tcggacagtgacatcacggtcctgcgacacctggagaaattgggctgccgcctagtcaac
cgcccacagagcattttaaactgcatcaacaaattctggacattccaagagctggctgga
catggggtgcccatgccagacactttctcctatggtgggcatgaagacttttcaaaaatg
atcgatgaagctgagcccctgggctacccggttgtggtgaagagcacgcgaggacaccag
ggaaaagctgtttttcttgcaagagataaacatcacatctcagacatctgccatctcatc
cgccatgatgtgccctacctgttccagaagtatgtgaaggagtcccacggaaaagatatc
cgggtggtggtggtagggggccaggtgataggctctatgctccgctgctccacggatgga
cggatgcagagcaactgctctcttggtggtgtgggtgtcatgtgcccgctgacagaacaa
ggcaagcagttggctattcaggtgtccaacatcctgggcatggacttctgtggcattgat
ctcctcatcatggacgatggctcttttgtggtgtgtgaggcaaacgccaacgtcggtttc
ctagccttcgaccaggcgtgcaacttagatgtgggtgggatcattgcagactacaccatg
tccttgctgccaaataggcagactgggaagatggccgtcctcccaggactgtcgagtccc
agggagaagaaagagccagatggctgtgcttcagctcagggagttgcagaaaacgtctac
accatcaacagtgggtctacctctagtgagagtgagcctgaactggcagagatccgagat
tcctcagcaagcacaacaggggccccgccccccatgctgcccgaacccggctacaacatt
aacaacaggattgcttcggaattaaaacttaagtga

DBGET integrated database retrieval system