KEGG   Enhydra lutris kenyoni (northern sea otter): 111143454
Entry
111143454         CDS       T05871                                 
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
elk  Enhydra lutris kenyoni (northern sea otter)
Pathway
elk00250  Alanine, aspartate and glutamate metabolism
elk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111143454
Enzymes [BR:elk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     111143454
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     111143454
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp CPSase_L_D2 Dala_Dala_lig_C Synapsin_C Rimk_N TTL
Other DBs
NCBI-GeneID: 111143454
NCBI-ProteinID: XP_022352919
UniProt: A0A2Y9IZU1
LinkDB
Position
Unknown
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTVVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCVNKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGRVIGSMLRCSTDGRMQSNCSLGGVGVMCPLTEQ
GKQLAVQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSCPREKKDPDGCASAQGVAESVYAINNGSTSSESEPELGEIRD
SSVSTTGAPPPMLPEAGYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
ctcatggaccagatcgccgtcaccgtcgtcggcggccacctcggcctgcagctgaaccag
aaggcgctcaccaccttccccgatgtggtgctcgtgcgggtgcccaccccctcagtgcag
tcggacagtgacatcacggtcctgcgccacctggagaagctgggctgccgcctagtcaac
cgcccgcagagcattttgaactgcgtcaacaagttctggacgttccaggagctggctggc
cacggggttcccatgccagacaccttctcatacggtgggcacgaagacttttcaaagatg
atcgatgaagctgagcccctgggctacccggtcgtggtgaagagcactcgaggacaccgg
ggaaaagctgtttttcttgccagagataaacatcacctctcggacatctgccatctgatc
cgccatgatgtgccctacctgttccagaagtatgtgaaggagtcacatggcaaagacatc
cgggtggtggtggtagggggccgggtgataggctccatgcttcgctgctccactgatgga
cggatgcagagcaactgctcactcggcggtgtgggtgtcatgtgcccgctgacagagcaa
ggcaagcagctggctgttcaggtgtccaacatcctgggcatggacttctgtggcatcgat
ctcctcatcatggacgacggctcctttgtggtgtgtgaggcgaacgccaatgtcggcttc
ctagccttcgaccaggcgtgcaatttagatgtgggtggcatcatcgcagactacaccatg
tccttgctgcccaataggcagactggcaagatggccgtcctcccaggactgtcctgtccc
agggagaagaaagacccagatggctgcgcttcagctcagggagttgcagagagcgtctac
gccatcaacaatgggtctacctctagtgagagtgagcctgaactgggagagatccgggat
tcctcagtgagcacaacgggggccccgccccccatgctgcccgaagccggctacaacatt
aacaacaggattgcttccgaattaaaacttaagtga

DBGET integrated database retrieval system