KEGG   Felis catus (domestic cat): 101080604
Entry
101080604         CDS       T02385                                 
Symbol
CD247
Name
(RefSeq) T-cell surface glycoprotein CD3 zeta chain isoform X1
  KO
K06453  CD3Z antigen, zeta polypeptide
Organism
fca  Felis catus (domestic cat)
Pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca05142  Chagas disease
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101080604 (CD247)
   04660 T cell receptor signaling pathway
    101080604 (CD247)
   04658 Th1 and Th2 cell differentiation
    101080604 (CD247)
   04659 Th17 cell differentiation
    101080604 (CD247)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101080604 (CD247)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101080604 (CD247)
   05169 Epstein-Barr virus infection
    101080604 (CD247)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101080604 (CD247)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101080604 (CD247)
   04090 CD molecules [BR:fca04090]
    101080604 (CD247)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101080604 (CD247)
CD molecules [BR:fca04090]
 Proteins
  101080604 (CD247)
SSDB
Motif
Pfam: ITAM TCR_zetazeta
Other DBs
NCBI-GeneID: 101080604
NCBI-ProteinID: XP_023103509
LinkDB
Position
F1:complement(12247822..12322147)
AA seq 183 aa
MAATASASWCHPGGKDKGMWKVLVIMALLQAQLPGTEAQSFGLLDPKLCYLVDGILFIYG
VIITALFLRAKFGRSAAAPASQQGANQLYNELNLGGRQEYEVLDKRRGLDPEMGGKQQRR
RNPPEVVYNALQKDKMAEAYSEIGIKGDNQRRRGKGHDGLYQGLSTATKDTYDALHMQTL
PPR
NT seq 552 nt   +upstreamnt  +downstreamnt
atggcggccacagcctcggcctcctggtgccaccctgggggaaaggacaaggggatgtgg
aaggtgcttgtcatcatggccctgctgcaggcacagctcccaggaacagaggcgcagagt
tttggcctgctggatcccaaactgtgctacctggtggacggaatccttttcatctatggc
gtcattatcactgccctgttcctgagagcaaagttcggcaggagcgcggccgcccccgcg
agccagcagggcgccaaccagctctacaacgagctcaatctgggaggaagacaggagtac
gaagttttggataagagacgaggcctggaccctgagatgggaggaaaacagcagaggagg
aggaatcctccggaagtcgtgtacaatgcactgcaaaaagacaagatggcggaggcctac
agtgagattgggataaaaggcgacaaccagcggcggagagggaaggggcatgatggcctc
taccaggggctcagcacggccaccaaggacacctatgacgccctccacatgcagaccctg
ccccctcgctaa

KEGG   Felis catus (domestic cat): 101083107
Entry
101083107         CDS       T02385                                 
Symbol
CD3D
Name
(RefSeq) T-cell surface glycoprotein CD3 delta chain isoform X1
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca05142  Chagas disease
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101083107 (CD3D)
   04660 T cell receptor signaling pathway
    101083107 (CD3D)
   04658 Th1 and Th2 cell differentiation
    101083107 (CD3D)
   04659 Th17 cell differentiation
    101083107 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101083107 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101083107 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    101083107 (CD3D)
   05162 Measles
    101083107 (CD3D)
   05169 Epstein-Barr virus infection
    101083107 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101083107 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    101083107 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101083107 (CD3D)
CD molecules [BR:fca04090]
 Proteins
  101083107 (CD3D)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5
Other DBs
NCBI-GeneID: 101083107
NCBI-ProteinID: XP_003992512
Ensembl: ENSFCAG00000011774
UniProt: M3WFR0
LinkDB
Position
D1:complement(15933907..15937474)
AA seq 170 aa
MEHSSFLAGLILSVLLSQVSPYKISVEELEDKVLLSCNTSIIRMEGTMGTLFRNDTNLDL
GKRILDPRGVYTCKRPDEQDKIPYTQVYYRMCQNCVELNSGTLAGIIIGDIIATLFLALG
VYCFAGYETGRLSEAADTQALLGNDQLYQPLRDRNDAQYSHLGENWPRKK
NT seq 513 nt   +upstreamnt  +downstreamnt
atggaacactccagttttctggccggcctgatactgtctgtccttctctcccaagtgagt
ccctacaagatatccgtggaggaactggaggacaaggtgttgctgagttgtaacaccagc
atcatacggatggagggaacgatgggaacgctattccgcaacgatacaaatctggacctg
ggaaaacgcatcctggacccacgaggagtgtatacgtgcaagaggccagacgaacaagac
aagataccttacacgcaagtatattatcgaatgtgtcagaactgtgtggaactgaactca
ggcaccctggccggcatcatcatcggggacataatcgccactcttttcctcgctttgggg
gtctattgctttgcgggatatgagaccggaaggctctctgaggctgctgacactcaagct
ctcctgggaaatgaccagctctatcagcccctgcgagatcggaatgatgctcagtacagt
catcttggtgaaaactggcctcggaagaagtga

KEGG   Felis catus (domestic cat): 101089292
Entry
101089292         CDS       T02385                                 
Symbol
CD3G
Name
(RefSeq) T-cell surface glycoprotein CD3 gamma chain
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca05142  Chagas disease
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101089292 (CD3G)
   04660 T cell receptor signaling pathway
    101089292 (CD3G)
   04658 Th1 and Th2 cell differentiation
    101089292 (CD3G)
   04659 Th17 cell differentiation
    101089292 (CD3G)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101089292 (CD3G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101089292 (CD3G)
   05170 Human immunodeficiency virus 1 infection
    101089292 (CD3G)
   05162 Measles
    101089292 (CD3G)
   05169 Epstein-Barr virus infection
    101089292 (CD3G)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101089292 (CD3G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    101089292 (CD3G)
CD molecules [BR:fca04090]
 Proteins
  101089292 (CD3G)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3 Ig_2
Other DBs
NCBI-GeneID: 101089292
NCBI-ProteinID: XP_003992456
Ensembl: ENSFCAG00000011777
LinkDB
Position
D1:15938575..15946673
AA seq 182 aa
MEQGKQLAGLILAVTLLQGTLAQSKQEIPVVRVNSDREDGSVLLTCESPDKDVKWFQDGK
EMTPHKKNKNIQNLGSSIKDPRGIYWCQGSKNRSRTLQVYFRMCQNCIELSGATVSGFVF
TEIISVFFLAVGVYFIAGQDGVRQSRASDKQTLLSNDQLYQPLKDRENDHYSHLQGKQLR
KN
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagcaggggaagcagctggctggcctcatcctggccgtcactcttcttcaaggtact
ctggcccagtcaaaacaagaaattcctgtggtaagagtaaacagcgatcgagaagatggt
tcggtacttctgacttgtgagtcaccagacaaagatgtcaaatggtttcaagatgggaag
gaaatgacgccccacaaaaagaataaaaatatacagaatctgggaagcagtatcaaggac
cctcgagggatatattggtgtcaaggatccaagaaccgctcaagaacactccaagtgtat
ttcagaatgtgtcagaactgcattgaactaagcggagccaccgtatccggctttgtcttc
actgagatcatcagcgttttcttccttgctgttggggtctacttcattgctggacaggat
ggagttcgccagtcaagagcttcggacaagcagactctgttgtccaatgaccagctctac
cagcccctgaaggatcgggaaaatgaccattacagccaccttcaaggaaaacaattgagg
aaaaattga

KEGG   Felis catus (domestic cat): 111559549
Entry
111559549         CDS       T02385                                 
Name
(RefSeq) uncharacterized protein LOC111559549
  KO
K10785  T-cell receptor beta chain V region
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04064  NF-kappa B signaling pathway
fca04514  Cell adhesion molecules
fca04612  Antigen processing and presentation
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05135  Yersinia infection
fca05142  Chagas disease
fca05144  Malaria
fca05150  Staphylococcus aureus infection
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05202  Transcriptional misregulation in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05310  Asthma
fca05320  Autoimmune thyroid disease
fca05321  Inflammatory bowel disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    111559549
   04015 Rap1 signaling pathway
    111559549
   04064 NF-kappa B signaling pathway
    111559549
   04020 Calcium signaling pathway
    111559549
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    111559549
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    111559549
   04660 T cell receptor signaling pathway
    111559549
   04658 Th1 and Th2 cell differentiation
    111559549
   04659 Th17 cell differentiation
    111559549
   04672 Intestinal immune network for IgA production
    111559549
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    111559549
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    111559549
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111559549
   05170 Human immunodeficiency virus 1 infection
    111559549
   05162 Measles
    111559549
   05169 Epstein-Barr virus infection
    111559549
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    111559549
   05150 Staphylococcus aureus infection
    111559549
  09174 Infectious disease: parasitic
   05144 Malaria
    111559549
   05142 Chagas disease
    111559549
  09163 Immune disease
   05310 Asthma
    111559549
   05322 Systemic lupus erythematosus
    111559549
   05323 Rheumatoid arthritis
    111559549
   05320 Autoimmune thyroid disease
    111559549
   05321 Inflammatory bowel disease
    111559549
   05330 Allograft rejection
    111559549
   05332 Graft-versus-host disease
    111559549
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111559549
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111559549
SSDB
Motif
Pfam: V-set Ig_2 Ig_3 ig 5HT_transport_N
Other DBs
NCBI-GeneID: 111559549
NCBI-ProteinID: XP_023106410
LinkDB
Position
A2:158363610..158364496
AA seq 247 aa
MSLGLLCCVALGLLQAGPVNAGITQTPAFQILGAGHSMTLRCEQDKDHDYMSWYRQDPGH
GLRLIHYSVSAGTTERGEISNGYNVSRSNTKNFPLTLTSATPSQTSVYFCASSDYTALHS
CLLSAQKKAGGGPAPRDSAEPSAHSQPPRPDPSPRAPRGPSAQSEPRCGLRSVCKALTAW
PGPDQTSGGHVSTSGLCSEPPGWLRRCFPSSDCSTPCLSLMLPGWKLFALGKQHNVLLTM
CYEIRSI
NT seq 744 nt   +upstreamnt  +downstreamnt
atgagcctcggcctcctgtgctgtgtggccctgggtctcctgcaggcagggcccgtgaat
gctggcatcactcagacccccgcattccagatcctgggggcaggacacagcatgacgctg
agatgtgaacaggacaaggaccacgactacatgtcctggtatcgacaagaccctggacat
gggctgcggctgatccattactccgtcagtgctggtaccaccgagagaggagaaatctcc
aacggatacaacgtctctaggtcaaatacaaagaacttccctctcacgctgacgtctgca
actccctcccagacatctgtgtacttctgtgccagcagtgactacacagcgctgcacagc
tgtctcctctctgcacaaaaaaaggcagggggagggcctgcgccccgggactcggcagag
ccctcggcacactcccagcccccccgccccgacccgagccccagagccccgaggggccca
agcgcccagagtgaacctcggtgtgggctgaggtccgtctgcaaggcactgacagcctgg
cctggacccgaccagacctcaggcggccatgtctccacctctggtctgtgctctgagccg
cctggctggctgcgaaggtgcttccccagctctgactgttctaccccctgcctaagtctg
atgcttccgggatggaaattgttcgcactgggtaaacagcacaatgtgttattaacaatg
tgttatgaaatcagatctatctag

KEGG   Felis catus (domestic cat): 493936
Entry
493936            CDS       T02385                                 
Symbol
CD3E
Name
(RefSeq) T-cell surface glycoprotein CD3 epsilon chain precursor
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca05142  Chagas disease
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    493936 (CD3E)
   04660 T cell receptor signaling pathway
    493936 (CD3E)
   04658 Th1 and Th2 cell differentiation
    493936 (CD3E)
   04659 Th17 cell differentiation
    493936 (CD3E)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    493936 (CD3E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493936 (CD3E)
   05170 Human immunodeficiency virus 1 infection
    493936 (CD3E)
   05162 Measles
    493936 (CD3E)
   05169 Epstein-Barr virus infection
    493936 (CD3E)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    493936 (CD3E)
  09163 Immune disease
   05340 Primary immunodeficiency
    493936 (CD3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    493936 (CD3E)
CD molecules [BR:fca04090]
 Proteins
  493936 (CD3E)
SSDB
Motif
Pfam: Ig_5 Ig_4 Ig_2 ITAM Ig_3 P5-ATPase ig
Other DBs
NCBI-GeneID: 493936
NCBI-ProteinID: NP_001009862
UniProt: Q5R1Q1
LinkDB
Position
D1:15887527..15927614
AA seq 202 aa
MPSGSLWRVLGLCLLSVGAWGQEDNEDPLEPSPQTSASARYKVSISGTTVVLTCPEDLGS
ESIKWERNGDLLPNEYGEQLFLDDFSEMENSGYYACYTSNSLEKNYLYLKARVCQNCVEV
DTMTAVAIVVADVCITLGFLLLVYYWSKNKKASSVTMMRGPGAGGRPRGQNKEKPPPVPN
PDYEPIRKGQQDLYSGLNQRGI
NT seq 609 nt   +upstreamnt  +downstreamnt
atgccatcgggaagcctctggagagttctgggactctgtctcctgtcagttggcgcttgg
gggcaggaagacaatgaagaccctttagagccatctccacagacatctgcctccgcacgg
tacaaagtctccatttctggaaccacggtggtgctgacatgccctgaggatttgggaagt
gaatccataaaatgggaaagaaacggtgacctcttgcccaatgaatatggagaacagcta
tttctggatgatttttcagaaatggaaaacagtggttattatgcctgctatacaagcaac
tcactagagaagaactatctctacctgaaagcaagagtgtgtcagaactgcgtggaggtg
gatacgatgacagcggtcgcgatcgtcgtggctgatgtctgtatcactctggggttcctg
ctgctggtatattattggagcaagaataaaaaggccagttccgtgaccatgatgcgagga
ccaggtgcaggcggcaggcccaggggacaaaacaaggagaaaccaccacctgtgcccaat
ccagactacgagcccatccggaaaggccagcaggatctgtattctggcctgaatcagaga
ggcatctga

DBGET integrated database retrieval system