Felis catus (domestic cat): 101083957 Help Entry 101083957         CDS       T02385                                  Name (RefSeq) interstitial collagenase-like   KO K01388   matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7] Organism fca  Felis catus (domestic cat) Pathway fca03320   PPAR signaling pathway fca04657   IL-17 signaling pathway fca04926   Relaxin signaling pathway fca05171   Coronavirus disease - COVID-19 fca05200   Pathways in cancer fca05219   Bladder cancer fca05323   Rheumatoid arthritis fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     101083957   09152 Endocrine system    03320 PPAR signaling pathway     101083957    04926 Relaxin signaling pathway     101083957  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101083957   09162 Cancer: specific types    05219 Bladder cancer     101083957   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     101083957   09163 Immune disease    05323 Rheumatoid arthritis     101083957   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101083957  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:fca01002]     101083957 Enzymes [BR:fca01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.24  Metalloendopeptidases     3.4.24.7  interstitial collagenase      101083957 Peptidases and inhibitors [BR:fca01002]  Metallo peptidases   Family M10    101083957 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Peptidase_M10 PG_binding_1 Motif Other DBs NCBI-GeneID:  101083957 NCBI-ProteinID:  XP_044894894 LinkDB All DBs Position D1:complement(1370782..1371962) Genome browser AA seq 159 aa AA seqDB search MQKFFGLKVTGRPDAETLHVMQQGWCGGPDVAPYVLTEGNPRWEHTDLTYRIENYTPDLP RAEVDRAIEKAFQLWSDVSPLTFTKVSEGQADIMLSFGEIMAVSPTLAESEARLLMCSRQ EGAWEEVFILMRKKHGPMTSECFLYKNAFSQVGQLCDQP NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgcagaaattctttgggctgaaggtgactgggcggccagatgccgagaccctgcacgtg atgcagcagggctggtgtggggggcccgacgtggctccctacgtcctcactgaggggaac cctcgatgggagcacacagacctgacctacaggattgaaaactacacaccagatctgcca agagcagaggtggaccgtgccattgagaaagcctttcaactctggagtgatgtctcaccc ctgaccttcaccaaggtctctgagggtcaagcggacataatgttatcctttggggagatc atggcggtaagtccgactttggcagaatcagaagcccgcttgctcatgtgttcgcgccag gaaggggcatgggaggaggtgttcattttgatgaggaaaaaacatggaccgatgacttca gaatgttttctctacaagaatgcctttagtcaagtgggccagctttgtgatcagccttaa

DBGET integrated database retrieval system