KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137769
Entry
101137769         CDS       T02442                                 
Symbol
RIMKLA
Name
(RefSeq) N-acetylaspartylglutamate synthase A
  KO
K18311  N-acetylaspartylglutamate/N-acetylaspartylglutamylglutamate synthase [EC:6.3.2.41 6.3.2.42]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00250  Alanine, aspartate and glutamate metabolism
ggo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101137769 (RIMKLA)
Enzymes [BR:ggo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.41  N-acetylaspartylglutamate synthase
     101137769 (RIMKLA)
    6.3.2.42  N-acetylaspartylglutamylglutamate synthase
     101137769 (RIMKLA)
SSDB
Motif
Pfam: RimK GSH-S_ATP ATPgrasp_ST ATP-grasp_3 ATP-grasp Dala_Dala_lig_C CPSase_L_D2 Rimk_N Synapsin_C TTL
Other DBs
NCBI-GeneID: 101137769
NCBI-ProteinID: XP_004025619
Ensembl: ENSGGOG00000025939
UniProt: G3S078
LinkDB
Position
1:38185245..38222624
AA seq 391 aa
MCSQLWFLTDRRIREDYPQVQILRALRQRCSEQDVRFRAVLMDQIAVTIVGGHLGLQLNQ
KALTTFPDVVLVRVPTPSVQSDSDITVLRHLEKLGCRLVNRPQSILNCINKFWTFQELAG
HGVPMPDTFSYGGHEDFSKMIDEAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLI
RHDVPYLFQKYVKESHGKDIRVVVVGGQVIGSMLRCSTDGRMQSNCSLGGVGVKCPLTEQ
GKQLAIQVSNILGMDFCGIDLLIMDDGSFVVCEANANVGFLAFDQACNLDVGGIIADYTM
SLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRD
SSASTMGAPPSMLPEPGYNINNRIASELKLK
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgctcccagctctggttcctgacggaccggcgcatccgcgaggactacccgcaggtg
cagatcctgcgcgccctccggcagcgctgctccgagcaggacgtgcgcttccgggcggtg
cttatggaccagatcgccgtcaccatcgtcggcggccacctcggcctccagctaaaccag
aaggccctcaccaccttcccggatgtggtgcttgtacgggtacccacaccctcagtgcag
tcagacagtgacatcactgtcctgcgacacctggagaagctgggctgccggttggtcaat
cgcccacagagcatcttaaattgcatcaacaaattctggacgttccaagaactggctgga
catggggtccccatgccagacaccttctcctatggtgggcatgaagacttttcaaaaatg
attgatgaagctgagcccctgggctacccagtcgtggtgaagagcacacgaggccaccgg
ggaaaagctgtttttctggcaagagataaacatcacctctctgacatctgccatctgatc
cgccacgatgtgccctacctgttccagaagtacgtgaaggagtcccatggaaaggacatc
cgggtggtggtggtagggggccaggtcataggctctatgcttcgctgctccactgatgga
cggatgcagagcaactgctctctcggtggcgtgggcgtcaagtgtccgctgacagaacaa
ggcaagcagttggctattcaggtgtccaacatcctaggcatggacttctgtggcattgat
ctccttatcatggacgatggctcctttgtggtgtgtgaggcaaatgctaatgtcggcttc
ctagccttcgaccaggcatgcaacttagatgtgggtgggatcattgcagactataccatg
tccttgctgccaaataggcagactggaaagatggctgtcctcccaggactgtcgagtccg
agggagaagaacgagccggatggctgtgcttcagctcagggagttgcagagagcgtctat
accatcaacagtgggtctacctctagcgaaagtgagcctgaactgggagagatccgggat
tcctcagcaagcacaatgggggccccaccctccatgctgcccgaacctggctacaacatt
aacaacaggattgcttctgagttaaaacttaagtga

DBGET integrated database retrieval system