Heterocephalus glaber (naked mole-rat): 101696390 Help Entry 101696390         CDS       T02812                                  Name (RefSeq) caspase-3   KO K02187   caspase 3 [EC:3.4.22.56] Organism hgl  Heterocephalus glaber (naked mole-rat) Pathway hgl01524   Platinum drug resistance hgl04010   MAPK signaling pathway hgl04115   p53 signaling pathway hgl04148   Efferocytosis hgl04210   Apoptosis hgl04215   Apoptosis - multiple species hgl04623   Cytosolic DNA-sensing pathway hgl04650   Natural killer cell mediated cytotoxicity hgl04657   IL-17 signaling pathway hgl04668   TNF signaling pathway hgl04726   Serotonergic synapse hgl04932   Non-alcoholic fatty liver disease hgl04933   AGE-RAGE signaling pathway in diabetic complications hgl04936   Alcoholic liver disease hgl05010   Alzheimer disease hgl05012   Parkinson disease hgl05014   Amyotrophic lateral sclerosis hgl05016   Huntington disease hgl05020   Prion disease hgl05022   Pathways of neurodegeneration - multiple diseases hgl05132   Salmonella infection hgl05133   Pertussis hgl05134   Legionellosis hgl05145   Toxoplasmosis hgl05146   Amoebiasis hgl05152   Tuberculosis hgl05160   Hepatitis C hgl05161   Hepatitis B hgl05162   Measles hgl05163   Human cytomegalovirus infection hgl05164   Influenza A hgl05165   Human papillomavirus infection hgl05167   Kaposi sarcoma-associated herpesvirus infection hgl05168   Herpes simplex virus 1 infection hgl05169   Epstein-Barr virus infection hgl05170   Human immunodeficiency virus 1 infection hgl05200   Pathways in cancer hgl05203   Viral carcinogenesis hgl05205   Proteoglycans in cancer hgl05206   MicroRNAs in cancer hgl05210   Colorectal cancer hgl05222   Small cell lung cancer hgl05416   Viral myocarditis hgl05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:hgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101696390    04668 TNF signaling pathway     101696390  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     101696390   09143 Cell growth and death    04210 Apoptosis     101696390    04215 Apoptosis - multiple species     101696390    04115 p53 signaling pathway     101696390  09150 Organismal Systems   09151 Immune system    04623 Cytosolic DNA-sensing pathway     101696390    04650 Natural killer cell mediated cytotoxicity     101696390    04657 IL-17 signaling pathway     101696390   09156 Nervous system    04726 Serotonergic synapse     101696390  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101696390    05206 MicroRNAs in cancer     101696390    05205 Proteoglycans in cancer     101696390    05203 Viral carcinogenesis     101696390   09162 Cancer: specific types    05210 Colorectal cancer     101696390    05222 Small cell lung cancer     101696390   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101696390    05161 Hepatitis B     101696390    05160 Hepatitis C     101696390    05164 Influenza A     101696390    05162 Measles     101696390    05168 Herpes simplex virus 1 infection     101696390    05163 Human cytomegalovirus infection     101696390    05167 Kaposi sarcoma-associated herpesvirus infection     101696390    05169 Epstein-Barr virus infection     101696390    05165 Human papillomavirus infection     101696390   09171 Infectious disease: bacterial    05132 Salmonella infection     101696390    05133 Pertussis     101696390    05134 Legionellosis     101696390    05152 Tuberculosis     101696390   09174 Infectious disease: parasitic    05146 Amoebiasis     101696390    05145 Toxoplasmosis     101696390   09164 Neurodegenerative disease    05010 Alzheimer disease     101696390    05012 Parkinson disease     101696390    05014 Amyotrophic lateral sclerosis     101696390    05016 Huntington disease     101696390    05020 Prion disease     101696390    05022 Pathways of neurodegeneration - multiple diseases     101696390   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101696390    05416 Viral myocarditis     101696390   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101696390    04932 Non-alcoholic fatty liver disease     101696390    04933 AGE-RAGE signaling pathway in diabetic complications     101696390   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     101696390  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:hgl01002]     101696390 Enzymes [BR:hgl01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.56  caspase-3      101696390 Peptidases and inhibitors [BR:hgl01002]  Cysteine peptidases   Family C14: caspase family    101696390 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  101696390 NCBI-ProteinID:  XP_012923258 UniProt:  A0AAX6QPN8 LinkDB All DBs Position Un AA seq 277 aa AA seqDB search MENTENSVDTKSMKDLETKIIHRSKSMDSGISLDNRYKMDYPEIGLCIIINNKNFHRSTG MSARSGTDVDAANLREIFMNLKYEVRNKNDLKCEEIVKLMCSVSKEDHSKRSSFICVILS HGEEGIIFGTNGPIDLKILTKFFRGDLCRSLAGKPKLFIIQACQGTELDSGTKTDSGIDD DMACQKIPVEADFLYAYSTAPGYHSWRNSKDGSWFIQSLCATVKLYAHNLEFMHILTRVN RKVATEFESFSYDSTFRPKKQIPCIVSMLTKELYFYH NT seq 834 nt NT seq  +upstreamnt  +downstreamnt atggagaacactgaaaactcagtggatacaaaatccatgaaagatttagaaacaaagatc atacacagaagcaaatcaatggactctggaatatccttggataatagatacaaaatggat tatcctgaaataggtttatgcataattattaataataagaactttcatagaagcactgga atgtcagctcgatctggtacagatgtagatgcagcaaacctcagagaaatatttatgaac ttgaaatatgaagtgaggaataaaaatgatcttaagtgtgaagaaattgtgaaattgatg tgcagtgtttctaaagaagatcatagcaaaaggagcagctttatttgtgtaattctaagc catggtgaagaaggaataatttttggaacaaatggacccattgacctgaaaatattaaca aaattcttcagaggggatctttgtagaagtctagctggaaaacccaaacttttcattatt caggcctgccagggtacagaactggactctggcactaagacagacagtggtattgatgat gacatggcgtgccagaaaataccagtagaggctgacttcttgtatgcatattccacggca ccaggttaccattcctggcgaaattcaaaggatggatcctggttcattcagtcactttgt gctacggtgaaattgtatgcacacaaccttgagtttatgcacattcttactcgggttaac cggaaggtagcaacagaatttgaatccttttcctatgactccacttttcgtccaaagaaa caaattccatgtattgtgtccatgctcacaaaagaactatatttttatcactaa

DBGET integrated database retrieval system