KEGG   Homo sapiens (human): 100134444
Entry
100134444         CDS       T01001                                 
Symbol
KCNJ18, KIR2.6, TTPP2
Name
(RefSeq) potassium inwardly rectifying channel subfamily J member 18
  KO
K05005  potassium inwardly-rectifying channel subfamily J member 12/18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
Disease
H00747  Thyrotoxic hypokalemic periodic paralysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100134444 (KCNJ18)
  09156 Nervous system
   04725 Cholinergic synapse
    100134444 (KCNJ18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    100134444 (KCNJ18)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   100134444 (KCNJ18)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 DUF92
Other DBs
NCBI-GeneID: 100134444
NCBI-ProteinID: NP_001181887
OMIM: 613236
HGNC: 39080
Ensembl: ENSG00000260458
Vega: OTTHUMG00000175863
Pharos: B7U540(Tdark)
UniProt: B7U540
LinkDB
Position
17:21692523..21704612
AA seq 433 aa
MTAASRANPYSIVSLEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIAFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVAHGDLEPAEGHGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECLVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG
VLEQRPYRRGSEI
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaccgcggccagccgggccaacccctacagcatcgtgtcattggaggaggacgggctg
cacctggtcaccatgtcgggcgccaacggcttcggcaacggcaaggtgcacacgcggcgc
aggtgccgcaaccgcttcgtcaagaagaatggccagtgcaacattgcgttcgccaacatg
gacgagaagtcacagcgctacctggctgacatgttcaccacctgtgtggacatccgctgg
cgctacatgctgctcatcttctcgctggccttccttgcctcctggctgctgttcggcgtc
atcttctgggtcatcgcggtggcacacggtgacctggagccggctgagggccacggccgc
acaccctgtgtgatgcaggtgcacggcttcatggcggccttcctcttctccatcgagacg
cagaccaccatcggctacgggctgcgctgtgtgacggaggagtgcctggtggccgtcttc
atggtggtggcccagtccatcgtgggctgcatcatcgactccttcatgattggtgccatc
atggccaagatggcaaggcccaagaagcgggcacagacgctgctgttcagccacaacgcc
gtggtggccctgcgtgacggcaagctctgcctcatgtggcgtgtgggcaacctgcgcaag
agccacattgtggaggcccatgtgcgcgcgcagctcatcaagccgcgggtcaccgaggag
ggcgagtacatcccgctggaccagatcgacatcgatgtgggcttcgacaagggcctggac
cgcatctttctggtgtcgcccatcaccatcttgcatgaaattgacgaggccagcccgctc
ttcggcatcagccggcaggacctggagacggacgactttgagatcgtggtcatcctggaa
ggcatggtggaggccacagccatgaccacccaggcccgcagctcctacctggccaatgag
atcctgtggggtcaccgctttgagcccgtgctcttcgaggagaagaaccagtacaagatt
gactactcgcacttccacaagacctatgaggtgccctctacgccccgctgcagtgcgaag
gatctggtagagaacaagttcctgctgcccagtgccaactccttctgctatgagaacgag
ctggccttcctgagccgtgacgaggaggatgaggcggacggagaccaggacggccgaagc
cgggatggcctcagcccccaggccaggcatgactttgacagactccaggctggcggcggg
gtcctggagcagcggccctacagacgggggtcagagatctga

KEGG   Homo sapiens (human): 3759
Entry
3759              CDS       T01001                                 
Symbol
KCNJ2, ATFB9, HHBIRK1, HHIRK1, IRK1, KIR2.1, LQT7, SQT3
Name
(RefSeq) potassium inwardly rectifying channel subfamily J member 2
  KO
K04996  potassium inwardly-rectifying channel subfamily J member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
hsa04924  Renin secretion
hsa04971  Gastric acid secretion
Disease
H00215  Periodic paralysis
H00720  Long QT syndrome
H00725  Short QT syndrome
H00731  Atrial fibrillation
H00748  Andersen-Tawil syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    3759 (KCNJ2)
   04924 Renin secretion
    3759 (KCNJ2)
  09154 Digestive system
   04971 Gastric acid secretion
    3759 (KCNJ2)
  09156 Nervous system
   04725 Cholinergic synapse
    3759 (KCNJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3759 (KCNJ2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3759 (KCNJ2)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 Ion_trans DUF6057
Other DBs
NCBI-GeneID: 3759
NCBI-ProteinID: NP_000882
OMIM: 600681
HGNC: 6263
Ensembl: ENSG00000123700
Vega: OTTHUMG00000180351
Pharos: P63252(Tbio)
UniProt: P63252
Structure
LinkDB
Position
17:70169532..70180044
AA seq 427 aa
MGSVRTNRYSIVSSEEDGMKLATMAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN
VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKEGK
ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPIAVFMVVFQSIVGCIIDAFIIGAVM
AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG
EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG
MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD
LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP
LRRESEI
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgggcagtgtgcgaaccaaccgctacagcatcgtctcttcagaagaagacggtatgaag
ttggccaccatggcagttgcaaatggctttgggaacgggaagagtaaagtccacacccga
caacagtgcaggagccgctttgtgaagaaagatggccactgtaatgttcagttcatcaat
gtgggtgagaaggggcaacggtacctcgcagacatcttcaccacgtgtgtggacattcgc
tggcggtggatgctggttatcttctgcctggctttcgtcctgtcatggctgttttttggc
tgtgtgttttggttgatagctctgctccatggggacctggatgcatccaaagagggcaaa
gcttgtgtgtccgaggtcaacagcttcacggctgccttcctcttctccattgagacccag
acaaccataggctatggtttcagatgtgtcacggatgaatgcccaattgctgttttcatg
gtggtgttccagtcaatcgtgggctgcatcatcgatgctttcatcattggcgcagtcatg
gccaagatggcaaagccaaagaagagaaacgagactcttgtcttcagtcacaatgccgtg
attgccatgagagacggcaagctgtgtttgatgtggcgagtgggcaatcttcggaaaagc
cacttggtggaagctcatgttcgagcacagctcctcaaatccagaattacttctgaaggg
gagtatatccctctggatcaaatagacatcaatgttgggtttgacagtggaatcgatcgt
atatttctggtgtccccaatcactatagtccatgaaatagatgaagacagtcctttatat
gatttgagtaaacaggacattgacaacgcagactttgaaatcgtggtcatactggaaggc
atggtggaagccactgccatgacgacacagtgccgtagctcttatctagcaaatgaaatc
ctgtggggccaccgctatgagcctgtgctctttgaagagaagcactactacaaagtggac
tattccaggttccacaaaacttacgaagtccccaacactcccctttgtagtgccagagac
ttagcagaaaagaaatatatcctctcaaatgcaaattcattttgctatgaaaatgaagtt
gccctcacaagcaaagaggaagacgacagtgaaaatggagttccagaaagcactagtacg
gacacgccccctgacatagaccttcacaaccaggcaagtgtacctctagagcccaggccc
ttacggcgagagtcggagatatga

KEGG   Homo sapiens (human): 3761
Entry
3761              CDS       T01001                                 
Symbol
KCNJ4, HIR, HIRK2, HRK1, IRK-3, IRK3, Kir2.3
Name
(RefSeq) potassium inwardly rectifying channel subfamily J member 4
  KO
K04998  potassium inwardly-rectifying channel subfamily J member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    3761 (KCNJ4)
  09156 Nervous system
   04725 Cholinergic synapse
    3761 (KCNJ4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3761 (KCNJ4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3761 (KCNJ4)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 3761
NCBI-ProteinID: NP_004972
OMIM: 600504
HGNC: 6265
Ensembl: ENSG00000168135
Vega: OTTHUMG00000151131
Pharos: P48050(Tchem)
UniProt: P48050 A0A024R1L8
Structure
LinkDB
Position
22:complement(38426327..38455199)
AA seq 445 aa
MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM
IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG
FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK
RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR
DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT
TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV
LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG
SHLDLERMQASLPLDNISYRRESAI
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcacggacacagccgcaacggccaggcccacgtgccccggcggaagcgccgcaaccgc
ttcgtcaagaagaacggccaatgcaacgtgtacttcgccaacctgagcaacaagtcgcag
cgctacatggcggacatcttcaccacctgcgtggacacgcgctggcgctacatgctcatg
atcttctccgcggccttccttgtctcctggctctttttcggcctcctcttctggtgtatc
gccttcttccacggtgacctggaggccagcccaggggtgcctgcggcggggggcccggcg
gcgggtggtggcggagcagccccggtggcccccaagccctgcatcatgcacgtgaacggc
ttcctgggtgccttcctgttctcggtggagacgcagacgaccatcggctatgggttccgg
tgcgtgacagaggagtgcccgctggcagtcatcgctgtggtggtccagtccatcgtgggc
tgcgtcatcgactccttcatgattggcaccatcatggccaagatggcgcggcccaagaag
cgggcgcagacgttgctgttcagccaccacgcggtcatttcggtgcgcgacggcaagctc
tgcctcatgtggcgcgtgggcaacctgcgcaagagccacattgtggaggcccacgtgcgg
gcccagctcatcaagccctacatgacccaggagggcgagtacctgcccctggaccagcgg
gacctcaacgtgggctatgacatcggcctggaccgcatcttcctggtgtcgcccatcatc
attgtccacgagatcgacgaggacagcccgctttatggcatgggcaaggaggagctggag
tcggaggactttgagatcgtggtcatcctggagggcatggtggaggccacggccatgacc
acccaggcccgcagctcctacctggccagcgagatcctgtggggccaccgctttgagcct
gtggtcttcgaggagaagagccactacaaggtggactactcacgttttcacaagacctac
gaggtggccggcacgccctgctgctcggcccgggagctgcaggagagtaagatcaccgtg
ctgcccgccccaccgccccctcccagtgccttctgctacgagaacgagctggcccttatg
agccaggaggaagaggagatggaggaggaggcagctgcggcggccgcggtggccgcaggc
ctgggcctggaggcgggttccaaggaggaggcgggcatcatccggatgctggagttcggc
agccacctggacctggagcgcatgcaggcttccctcccgctggacaacatctcctaccgc
agggagtctgccatctga

KEGG   Homo sapiens (human): 3768
Entry
3768              CDS       T01001                                 
Symbol
KCNJ12, IRK-2, IRK2, KCNJN1, Kir2.2, hIRK, hIRK1, hkir2.2x, kcnj12x
Name
(RefSeq) potassium inwardly rectifying channel subfamily J member 12
  KO
K05005  potassium inwardly-rectifying channel subfamily J member 12/18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
Drug target
Amiodarone (DG00204): D00636<JP/US> D02910
Bepridil (DG00333): D00631<JP> D07520
Nifekalant hydrochloride: D01856<JP>
Terikalant: D09757
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    3768 (KCNJ12)
  09156 Nervous system
   04725 Cholinergic synapse
    3768 (KCNJ12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3768 (KCNJ12)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3768 (KCNJ12)
SSDB
Motif
Pfam: IRK_C IRK IRK_N Ion_trans_2 DUF92
Other DBs
NCBI-GeneID: 3768
NCBI-ProteinID: NP_066292
OMIM: 602323
HGNC: 6258
Ensembl: ENSG00000184185
Vega: OTTHUMG00000132039
Pharos: Q14500(Tbio)
UniProt: Q14500
LinkDB
Position
17:21376357..21419870
AA seq 433 aa
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGIIFWVIAVAHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGG
VLEQRPYRRESEI
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaccgcggccagccgggccaacccctacagcatcgtgtcatcggaggaggacgggctg
cacctggtcaccatgtcgggcgccaacggcttcggcaacggcaaggtgcacacgcggcgc
aggtgccgcaaccgcttcgtcaagaagaatggccagtgcaacattgagttcgccaacatg
gacgagaagtcacagcgctacctggctgacatgttcaccacctgtgtggacatccgctgg
cggtacatgctgctcatcttctcgctggccttccttgcctcctggctgctgttcggcatc
atcttctgggtcatcgcggtggcacacggtgacctggagccggctgagggccggggccgc
acaccctgtgtgatgcaggtgcacggcttcatggcggccttcctcttctccatcgagacg
cagaccaccatcggctacgggctgcgctgtgtgacggaggagtgcccggtggccgtcttc
atggtggtggcccagtccatcgtgggctgcatcatcgactccttcatgattggtgccatc
atggccaagatggcaaggcccaagaagcgggcacagacgctgctgttcagccacaacgcc
gtggtggccctgcgtgacggcaagctctgcctcatgtggcgtgtgggtaacctgcgcaag
agccacattgtggaggcccatgtgcgcgcgcagctcatcaagccgcgggtcaccgaggag
ggcgagtacatcccgctggaccagatcgacatcgatgtgggcttcgacaagggcctggac
cgcatctttctggtgtcgcccatcaccatcttgcatgagattgacgaggccagcccgctc
ttcggcatcagccggcaggacctggagacggacgactttgagatcgtggtcatcctggaa
ggcatggtggaggccacagccatgaccacccaggcccgcagctcctacctggccaatgag
atcctgtggggtcaccgctttgagcccgtgctcttcgaggagaagaaccagtacaagatt
gactactcgcacttccacaagacctatgaggtgccctctacgccccgctgcagtgcgaag
gatctggtagagaacaagttcctgctgcccagcgccaactccttctgctacgagaacgag
ctggccttcctgagccgtgacgaggaggatgaggcggacggagaccaggacggccgaagc
cgggacggcctcagcccccaggccaggcatgactttgacagactccaggctggcggcggg
gtcctggagcagcggccctacagacgggagtcagagatctga

KEGG   Homo sapiens (human): 3770
Entry
3770              CDS       T01001                                 
Symbol
KCNJ14, IRK4, KIR2.4
Name
(RefSeq) potassium inwardly rectifying channel subfamily J member 14
  KO
K05007  potassium inwardly-rectifying channel subfamily J member 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04725  Cholinergic synapse
hsa04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    3770 (KCNJ14)
  09156 Nervous system
   04725 Cholinergic synapse
    3770 (KCNJ14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3770 (KCNJ14)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3770 (KCNJ14)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 3770
NCBI-ProteinID: NP_037480
OMIM: 603953
HGNC: 6260
Ensembl: ENSG00000182324
Vega: OTTHUMG00000183307
Pharos: Q9UNX9(Tdark)
UniProt: Q9UNX9
LinkDB
Position
19:48455574..48466980
AA seq 436 aa
MGLARALRRLSGALDSGDSRAGDEEEAGPGLCRNGWAPAPVQSPVGRRRGRFVKKDGHCN
VRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLAFWLIASLHGDLAA
PPPPAPCFSHVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFV
VGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPR
VTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELV
VILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPV
CSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA
ASPRVLTPTLALTLPP
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgggcctggccagggccctacgccgcctcagcggcgccctggattcgggagacagccgg
gcgggcgatgaagaggaggccgggcccgggttgtgccgcaacgggtgggcgccggcaccg
gtgcagtcacccgtgggccggcgccgcggtcgcttcgtcaagaaagacgggcactgcaac
gtgcgtttcgtaaacctgggtggccagggcgcgcgctacctgagcgacctgttcaccaca
tgcgtggacgtgcgctggcgctggatgtgcctgctcttctcctgctccttcctcgcctcc
tggctgctcttcggcctggccttctggctcattgcctcgctgcacggcgacctggccgcc
ccgccaccgcccgcgccctgcttctcacacgtggccagcttcctggccgccttcctcttc
gcgctggagacgcagacgtccatcggctacggcgtgcgcagcgtcaccgaggagtgcccg
gccgctgtggccgccgtggtgctgcagtgcattgccggctgcgtgctcgacgccttcgtc
gtgggtgctgtcatggccaagatggccaaacccaagaagcgcaacgagacgctggtcttc
agcgagaacgccgtcgtggcgctgcgcgaccaccgcctctgcctcatgtggcgcgtcggc
aacctgcgccgcagccacctggtcgaggcccacgtgcgtgcccagctgctgcagccccgt
gtgaccccagagggtgagtacatcccgctggaccaccaggatgtggatgtgggctttgat
ggaggcaccgatcgtatcttcctcgtgtcccccatcaccatcgtccatgagatcgactct
gccagtcctctgtatgagctaggacgtgccgagctggccagggctgactttgagctggtg
gtcattctcgaggggatggttgaggccacagccatgaccacacagtgtcgctcgtcctac
ctccctggtgaactgctctggggccatcgttttgagccagttctcttccagcgtggctcc
cagtatgaggtcgactatcgccacttccatcgcacttatgaggtcccagggacaccggtc
tgcagtgctaaggagctggatgaacgggcagagcaggcttcccacagcctcaagtctagt
ttccccggctctctgactgcattttgttatgagaatgaacttgctctgagctgctgccag
gaggaagatgaggacgatgagactgaggaagggaatggggtggaaacagaagatggggct
gctagcccccgagttctcacaccaaccctggcgctgaccctgcctccatga

DBGET integrated database retrieval system