KEGG   Homo sapiens (human): 100526760
Entry
100526760         CDS       T01001                                 

Symbol
ABHD14A-ACY1
Name
(RefSeq) ABHD14A-ACY1 readthrough
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa01100  Metabolic pathways
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100526760 (ABHD14A-ACY1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    100526760 (ABHD14A-ACY1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    100526760 (ABHD14A-ACY1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     100526760 (ABHD14A-ACY1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M20
   100526760 (ABHD14A-ACY1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100526760 (ABHD14A-ACY1)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-GeneID: 100526760
NCBI-ProteinID: NP_001303260
HGNC: 38856
Ensembl: ENSG00000114786
Vega: OTTHUMG00000166447
UniProt: B4DNW0
LinkDB
Structure
PDB: 
1Q7L

Position
3p21.2
AA seq 498 aa
MWGCQAPLSRLPASGETPMSQSWLVSPLATRPSFTARCSHSTRHTGWRWCCFMERPLTLT
RGSSWAHCSYCHRGATGPWPLTFQLTTRSAMTSKGPEEEHPSVTLFRQYLRIRTVQPKPD
YGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEH
WSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVG
GHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRF
MEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMS
ASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRV
CKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDI
YTRLLPALASVPALPSDS
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgtggggctgccaggcccccctgagcagacttcctgcctctggggagaccccaatgtca
cagtcctggctggtctcacccctggcaactcgcccatcttttaccgcgaggtgctcccac
tcaaccaggcacacagggtggaggtggtgctgcttcatggaaaggcctttaactctcaca
cgtgggagcagctgggcacactgcagctactgtcacagaggggctaccgggccgtggccc
ttgaccttccagctcaccacgcgcagcgccatgaccagcaagggtcccgaggaggagcac
ccatcggtgacgctcttccgccagtacctgcgtatccgcactgtccagcccaagcctgac
tatggagctgctgtggctttctttgaggagacagcccgccagctgggcctgggctgtcag
aaagtagaggtggcacctggctatgtggtgaccgtgttgacctggccaggcaccaaccct
acactctcctccatcttgctcaactcccacacggatgtggtgcctgtcttcaaggaacat
tggagtcacgacccctttgaggccttcaaggattctgagggctacatctatgccaggggt
gcccaggacatgaagtgcgtcagcatccagtacctggaagctgtgaggaggctgaaggtg
gagggccaccggttccccagaaccatccacatgacctttgtgcctgatgaggaggttggg
ggtcaccaaggcatggagctgttcgtgcagcggcctgagttccacgccctgagggcaggc
tttgccctggatgagggcatagccaatcccactgatgccttcactgtcttttatagtgag
cggagtccctggtgggtgcgggttaccagcactgggaggccaggccatgcctcacgcttc
atggaggacacagcagcagagaagctgcacaaggttgtaaactccatcctggcattccgg
gagaaggaatggcagaggctgcagtcaaacccccacctgaaagaggggtccgtgacctcc
gtgaacctgactaagctagagggtggcgtggcctataacgtgatacctgccaccatgagc
gccagctttgacttccgtgtggcaccggatgtggacttcaaggcttttgaggagcagctg
cagagctggtgccaggcagctggcgagggggtcaccctagagtttgctcagaagtggatg
cacccccaagtgacacctactgatgactcaaacccttggtgggcagcttttagccgggtc
tgcaaggatatgaacctcactctggagcctgagatcatgcctgctgccactgacaaccgc
tatatccgcgcggtgggggtcccagctctaggcttctcacccatgaaccgcacacctgtg
ctgctgcacgaccacgatgaacggctgcatgaggctgtgttcctccgtggggtggacata
tatacacgcctgctgcctgcccttgccagtgtgcctgccctgcccagtgacagctga

KEGG   Homo sapiens (human): 95
Entry
95                CDS       T01001                                 

Symbol
ACY1, ACY-1, ACY1D, HEL-S-5
Name
(RefSeq) aminoacylase 1
  KO
K14677  aminoacylase [EC:3.5.1.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa01100  Metabolic pathways
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Disease
H01146  Aminoacylase 1 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    95 (ACY1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    95 (ACY1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    95 (ACY1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.14  N-acyl-aliphatic-L-amino acid amidohydrolase
     95 (ACY1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M20
   95 (ACY1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   95 (ACY1)
SSDB
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Other DBs
NCBI-GeneID: 95
NCBI-ProteinID: NP_000657
OMIM: 104620
HGNC: 177
Ensembl: ENSG00000243989
Vega: OTTHUMG00000157815
Pharos: Q03154(Tbio)
UniProt: Q03154 V9HWA0
LinkDB
Structure
PDB: 
1Q7L

Position
3p21.2
AA seq 408 aa
MTSKGPEEEHPSVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVV
TVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQ
YLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANP
TDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSN
PHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEG
VTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPAL
GFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASVPALPSDS
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgaccagcaagggtcccgaggaggagcacccatcggtgacgctcttccgccagtacctg
cgtatccgcactgtccagcccaagcctgactatggagctgctgtggctttctttgaggag
acagcccgccagctgggcctgggctgtcagaaagtagaggtggcacctggctatgtggtg
accgtgttgacctggccaggcaccaaccctacactctcctccatcttgctcaactcccac
acggatgtggtgcctgtcttcaaggaacattggagtcacgacccctttgaggccttcaag
gattctgagggctacatctatgccaggggtgcccaggacatgaagtgcgtcagcatccag
tacctggaagctgtgaggaggctgaaggtggagggccaccggttccccagaaccatccac
atgacctttgtgcctgatgaggaggttgggggtcaccaaggcatggagctgttcgtgcag
cggcctgagttccacgccctgagggcaggctttgccctggatgagggcatagccaatccc
actgatgccttcactgtcttttatagtgagcggagtccctggtgggtgcgggttaccagc
actgggaggccaggccatgcctcacgcttcatggaggacacagcagcagagaagctgcac
aaggttgtaaactccatcctggcattccgggagaaggaatggcagaggctgcagtcaaac
ccccacctgaaagaggggtccgtgacctccgtgaacctgactaagctagagggtggcgtg
gcctataacgtgatacctgccaccatgagcgccagctttgacttccgtgtggcaccggat
gtggacttcaaggcttttgaggagcagctgcagagctggtgccaggcagctggcgagggg
gtcaccctagagtttgctcagaagtggatgcacccccaagtgacacctactgatgactca
aacccttggtgggcagcttttagccgggtctgcaaggatatgaacctcactctggagcct
gagatcatgcctgctgccactgacaaccgctatatccgcgcggtgggggtcccagctcta
ggcttctcacccatgaaccgcacacctgtgctgctgcacgaccacgatgaacggctgcat
gaggctgtgttcctccgtggggtggacatatatacacgcctgctgcctgcccttgccagt
gtgcctgccctgcccagtgacagctga

DBGET integrated database retrieval system