KEGG   Homo sapiens (human): 10189
Entry
10189             CDS       T01001                                 
Symbol
ALYREF, ALY, ALY/REF, BEF, REF, THOC4
Name
(RefSeq) Aly/REF export factor
  KO
K12881  THO complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
hsa05168  Herpes simplex virus 1 infection
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10189 (ALYREF)
  09122 Translation
   03013 Nucleocytoplasmic transport
    10189 (ALYREF)
   03015 mRNA surveillance pathway
    10189 (ALYREF)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    10189 (ALYREF)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10189 (ALYREF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10189 (ALYREF)
   03041 Spliceosome [BR:hsa03041]
    10189 (ALYREF)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     10189 (ALYREF)
    TREX complex
     10189 (ALYREF)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    10189 (ALYREF)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    10189 (ALYREF)
SSDB
Motif
Pfam: RRM_1 FoP_duplication FYTT RRM_5
Other DBs
NCBI-GeneID: 10189
NCBI-ProteinID: NP_005773
OMIM: 604171
HGNC: 19071
Ensembl: ENSG00000183684
Vega: OTTHUMG00000160470
Pharos: Q86V81(Tbio)
UniProt: Q86V81 E9PB61
Structure
LinkDB
Position
17:complement(81887835..81891587)
AA seq 264 aa
MPDSAPAMADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGG
PIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNL
DFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDG
RPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRN
SKQQLSAEELDAQLDAYNARMDTS
NT seq 795 nt   +upstreamnt  +downstreamnt
atgcccgattccgcgcccgccatggccgacaaaatggacatgtctctggacgacatcatt
aaactgaaccggagccagcgaggcggccggggcgggggccggggccgcggccgggccggc
tcccagggcggccgcggcggtggggcgcaggccgccgcgcgagtgaatcgaggcggcggg
cccatccggaaccggccggccatcgcccgcggcgcggccggcggaggcggcaggaaccga
ccggcgccctacagcaggccaaaacaacttcccgacaagtggcagcacgatcttttcgac
agtggcttcggcggtggtgccggcgtggagacaggtgggaaactgctggtgtccaatctg
gattttggagtctcagacgccgatattcaggaactctttgctgaatttggaacgctgaag
aaggcggctgtgcactatgatcgctctggtcgcagcttaggaacagcagacgtgcacttt
gagcggaaggcagatgccctgaaggccatgaagcagtacaacggcgtccctctggatggc
cgccccatgaacattcagcttgtcacgtcacagattgacgcacagcggaggcctgcacag
agcgtaaacagaggtggcatgactagaaaccgtggcgctggaggttttggtggtggtgga
ggcacccggagaggcacccgcggaggcgcccgtggaagaggcagaggtgccggcaggaat
tcaaagcagcagctttcggcagaggagctggatgcccagctggacgcctataatgcgaga
atggacaccagttaa

DBGET integrated database retrieval system