KEGG   Homo sapiens (human): 10197
Entry
10197             CDS       T01001                                 

Symbol
PSME3, HEL-S-283, Ki, PA28-gamma, PA28G, PA28gamma, REG-GAMMA
Name
(RefSeq) proteasome activator subunit 3
  KO
K06698  proteasome activator subunit 3 (PA28 gamma)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa04612  Antigen processing and presentation
hsa05160  Hepatitis C
Network
nt06140  Transcription (viruses)
nt06163  Hepatitis C virus (HCV)
nt06263  Hepatocellular carcinoma
  Element
N00530  HCV core to RXRA/LXRA-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    10197 (PSME3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    10197 (PSME3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    10197 (PSME3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    10197 (PSME3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    10197 (PSME3)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    10197 (PSME3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   10197 (PSME3)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 10197
NCBI-ProteinID: NP_005780
OMIM: 605129
HGNC: 9570
Ensembl: ENSG00000131467
Vega: OTTHUMG00000180654
Pharos: P61289(Tbio)
UniProt: P61289 V9HWJ8
LinkDB
Position
17q21.31
AA seq 254 aa
MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHS
DMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIE
KVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS
RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIE
KIKRPRSSNAETLY
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcctcgttgctgaaggtggatcaggaagtgaagctcaaggttgattctttcagggag
cggatcacaagtgaggcagaagacttggtggcaaattttttcccaaagaagttattagaa
cttgatagttttctgaaggaaccaatcttaaacatccatgacctaactcagatccactct
gacatgaatctcccagtccctgaccccattcttctcaccaatagccatgatggactggat
ggtcccacttataagaagcgaaggttggatgagtgtgaagaagccttccaaggaaccaag
gtgtttgtgatgcccaatgggatgctgaaaagcaaccagcagctggtggacattattgag
aaagtgaaacctgagatccggctgttgattgagaaatgtaacacggtcaaaatgtgggta
cagctcctgattcccaggatagaagatggaaacaactttggggtgtccattcaggaggaa
acagttgcagagctaagaactgttgagagtgaagctgcatcttatctggaccagatttct
agatattatattacaagagccaaattggtttctaaaatagctaaatatccccatgtggag
gactatcgccgcaccgtgacagagattgatgagaaagaatatatcagccttcggctcatc
atatcagagctgaggaatcaatatgtcactctacatgacatgatcctgaaaaatatcgag
aagatcaaacggccccggagcagcaatgcagagactctgtactga

KEGG   Homo sapiens (human): 5720
Entry
5720              CDS       T01001                                 

Symbol
PSME1, HEL-S-129m, IFI5111, PA28A, PA28alpha, REGalpha
Name
(RefSeq) proteasome activator subunit 1
  KO
K06696  proteasome activator subunit 1 (PA28 alpha)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5720 (PSME1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    5720 (PSME1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5720 (PSME1)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    5720 (PSME1)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 5720
NCBI-ProteinID: NP_006254
OMIM: 600654
HGNC: 9568
Ensembl: ENSG00000092010
Vega: OTTHUMG00000028795
Pharos: Q06323(Tbio)
UniProt: Q06323 A0A0K0K1L8
LinkDB
Structure
PDB: 
1AVO

Position
14q12
AA seq 249 aa
MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPE
IKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSE
RGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKP
RGETKGMIY
NT seq 750 nt   +upstreamnt  +downstreamnt
atggccatgctcagggtccagcccgaggcccaagccaaggtggatgtgtttcgtgaagac
ctctgtaccaagacagagaacctgctcgggagctatttccccaagaagatttctgagctg
gatgcatttttaaaggagccagctctcaatgaagccaacttgagcaatctgaaggcccca
ttggacatcccagtgcctgatccagtcaaggagaaagagaaagaggagcggaagaaacag
caggagaaggaagacaaggatgaaaagaagaagggggaggatgaagacaaaggtcctccc
tgtggcccagtgaactgcaatgaaaagatcgtggtccttctgcagcgcttgaagcctgag
atcaaggatgtcattgagcagctcaacctggtcaccacctggttgcagctgcagatacct
cggattgaggatggtaacaattttggagtggctgtccaggagaaggtgtttgagctgatg
accagcctccacaccaagctagaaggcttccacactcaaatctctaagtatttctctgag
cgtggtgatgcagtgactaaagcagccaagcagccccatgtgggtgattatcggcagctg
gtgcacgagctggatgaggcagagtaccgggacatccggctgatggtcatggagatccgc
aatgcttatgctgtgttatatgacatcatcctgaagaacttcgagaagctcaagaagccc
aggggagaaacaaagggaatgatctattga

KEGG   Homo sapiens (human): 5721
Entry
5721              CDS       T01001                                 

Symbol
PSME2, PA28B, PA28beta, REGbeta
Name
(RefSeq) proteasome activator subunit 2
  KO
K06697  proteasome activator subunit 2 (PA28 beta)
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    5721 (PSME2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    5721 (PSME2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    5721 (PSME2)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    5721 (PSME2)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 5721
NCBI-ProteinID: NP_002809
OMIM: 602161
HGNC: 9569
Ensembl: ENSG00000100911
Vega: OTTHUMG00000028797
Pharos: Q9UL46(Tbio)
UniProt: Q9UL46 Q86SZ7
LinkDB
Position
14q12
AA seq 239 aa
MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSL
RAPLDIPIPDPPPKDDEMETDKQEKKEVHKCGFLPGNEKVLSLLALVKPEVWTLKEKCIL
VITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK
ETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccaagccgtgtggggtgcgcctgagcggggaagcccgcaaacaggtggaggtcttc
agacagaatcttttccaggaggctgaggaattcctctacagattcttgccacagaaaatc
atatacctgaatcagctcttgcaagaggactccctcaatgtggctgacttgacttccctc
cgggccccactggacatccccatcccagaccctccacccaaggatgatgagatggaaaca
gataagcaggagaagaaagaagtccataagtgtggatttctccctgggaatgagaaagtc
ctgtccctgcttgccctggttaagccagaagtctggactctcaaagagaaatgcattctg
gtgattacatggatccaacacctgatccccaagattgaagatggaaatgattttggggta
gcaatccaggagaaggtgctggagagggtgaatgccgtcaagaccaaagtggaagctttc
cagacaaccatttccaagtacttctcagaacgtggggatgctgtggccaaggcctccaag
gagactcatgtaatggattaccgggccttggtgcatgagcgagatgaggcagcctatggg
gagctcagggccatggtgctggacctgagggccttctatgctgagctttatcatatcatc
agcagcaacctggagaaaattgtcaacccaaagggtgaagaaaagccatctatgtactga

DBGET integrated database retrieval system