KEGG   Homo sapiens (human): 102723796
Entry
102723796         CDS       T01001                                 
Symbol
TLE7, chico
Name
(RefSeq) TLE family member 7
  KO
K04497  groucho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102723796 (TLE7)
   04330 Notch signaling pathway
    102723796 (TLE7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    102723796 (TLE7)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      102723796 (TLE7)
SSDB
Motif
Pfam: WD40 zinc_ribbon_9
Other DBs
NCBI-GeneID: 102723796
NCBI-ProteinID: NP_001354294
HGNC: 53648
Ensembl: ENSG00000260734
LinkDB
Position
16:complement(71429980..71442054)
AA seq 441 aa
MSGEKEEASLRMFGAYGEPEERRDVLESSGVSSQPEPQVQQQLGSLLGVPWQPPGPPIQH
SPADQETSTVTQQQWHLQGLGRSELQAAGLPDAQPGEAAESSPSFLLGSEVGQPYSSSSP
SEEVLSLLRAIPPIPDEVVVRQKRAPQGSWKVGTLFHGKRVYAVAISGSTHHVYTCGSGY
IRVWDESALHAGEKAPRAQLDLQHPQDRVVTCKLFPDERSLITGGASQAVTLWDLAPTPQ
VRAQLTSTGPTCYSLAVSSDAHICLACFHGFVEIWDLQNQILIRKHEVPVYGSRCVDITG
NIFWTGGEDTILYSWDLRSYQRLHQHNLQNEILSITHDPGEEWVLAGLRTSDIVFLHTRR
NEQFKALMKKYTRHHSLKFASCGSYFVTAIDTRLSGLEAPSLQKLFQIEESSGILCCDVS
SDNQYLVMGSSSSATIYQLLY
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgagtggagagaaggaagaggcatcgctcagaatgttcggggcttatggtgagccagag
gagaggagggatgtgctggaaagctctggcgtttcctctcagcctgagccacaagtgcag
cagcaactgggcagtctgttgggagtgccctggcagcccccgggccccccaatacagcac
agccctgctgatcaagagacaagcacggtgacccagcagcagtggcacctccagggcctg
ggtagatctgagctccaggccgctgggctccctgatgcacaaccaggagaagcagcagag
tccagcccaagcttcctactgggttctgaggttggccagccttactcttcttcctctccc
agtgaagaagtcctctcattgctcagagcaattccccccattccagatgaagttgtggtc
aggcagaagagggccccacagggctcctggaaggttggcacactcttccatggaaagaga
gtctacgctgtggccatcagcggctcaacccaccacgtgtacacgtgtggctctggctac
atcagggtatgggatgagagtgcgctgcatgcgggggagaaggcccctcgggcccagctg
gacttgcagcatccccaggaccgtgttgttacctgcaagctgttccctgatgagcggagc
ctgatcacagggggtgcgtcccaggccgtgactctctgggacttggcacccaccccccag
gtcagggcacagctgacctcgacgggccccacgtgctattctctggctgtctcctctgat
gcccatatctgtttggcttgtttccatggatttgttgagatttgggatttgcagaaccaa
atcttgatcaggaagcacgaagttcctgtatacgggtcccgatgtgtggacatcaccggc
aatatattctggacaggaggtgaagacaccatcctgtattcctgggacctgaggagctac
cagaggctgcaccaacacaacttacagaatgagatcctcagcattacccacgaccccggt
gaagaatgggtattggcgggcctgagaacgagtgatatcgtgttccttcacactcgtcgg
aatgagcagtttaaggctctcatgaaaaaatacacccgccaccacagcctcaagtttgcc
tcctgtgggagctattttgtgaccgcgatagatacgcgcctcagtggcttggaggcacct
tctctgcaaaagttgtttcagatagaggagtcttcaggtatcctgtgctgtgacgtgtcc
tctgacaaccagtatctggtcatgggctctagcagcagtgccaccatctaccagctcttg
tattaa

KEGG   Homo sapiens (human): 7088
Entry
7088              CDS       T01001                                 
Symbol
TLE1, ESG, ESG1, GRG1, TLE-1
Name
(RefSeq) TLE family member 1, transcriptional corepressor
  KO
K04497  groucho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7088 (TLE1)
   04330 Notch signaling pathway
    7088 (TLE1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7088 (TLE1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      7088 (TLE1)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 NBCH_WD40 HALZ Ribosomal_S18
Other DBs
NCBI-GeneID: 7088
NCBI-ProteinID: NP_005068
OMIM: 600189
HGNC: 11837
Ensembl: ENSG00000196781
Vega: OTTHUMG00000021008
Pharos: Q04724(Tbio)
UniProt: Q04724 Q59EF7
Structure
LinkDB
Position
9:complement(81583683..81689547)
AA seq 770 aa
MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN
AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIK
DDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSD
GDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLK
SKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRT
PLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG
FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT
LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP
DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV
WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI
FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN
LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgttcccgcagagccggcacccgacgccgcaccaggctgcaggccagcccttcaagttc
actatcccggagtccctggaccggattaaagaggaattccagttcctgcaggcgcagtat
cacagccttaaattggaatgtgagaaactggcaagtgaaaagacagaaatgcagaggcac
tatgtgatgtattatgaaatgtcatatggattaaacattgaaatgcacaaacagactgaa
atcgccaagagattgaatacgatttgtgcacaagtcatcccatttctgtctcaggaacat
caacaacaggtggcccaggctgttgaacgtgccaaacaggtgaccatggcagaattgaat
gccatcatcgggcagcagcagttgcaagctcagcatctttctcatggccacggaccccca
gttccccttacgcctcacccttcgggacttcagcctcctggaatcccgcccctcgggggc
agtgccggccttcttgcgctgtctagtgctctgagtgggcagtctcacttggcaataaaa
gatgacaagaagcaccacgatgcagagcaccacagagacagagagccgggcacaagtaat
tccctcctggtcccagacagtctaagaggcacagataaacgcagaaatggacctgaattt
tccaatgacatcaagaaaaggaaggtggatgataaggactccagccactatgacagtgat
ggtgacaaaagcgatgacaacttagttgtggatgtgtctaatgaggacccttcttctccg
cgagcaagccctgcccactcgccccgggaaaatggaatcgacaaaaatcgcctgctaaag
aaggatgcttctagcagtccagcttccacggcctcctcggcaagttccacttctttgaaa
tccaaagaaatgagcttgcatgaaaaagccagcacgcctgttctgaaatccagcacacca
acgcctcggagcgacatgccaacgccgggcaccagcgccactccaggcctccgtccaggt
ctcggcaagcctccagccatagaccccctcgttaaccaagcggcagctggcttgaggaca
cccctggcagtgcccggcccatatcctgctccttttgggatggtcccccacgctggcatg
aacggcgagctgaccagcccaggcgctgcctacgccagtttacacaacatgtcgccccag
atgagcgccgcagccgccgcggccgccgtggtggcctacgggcgctcccccatggtgggg
tttgatcctccccctcacatgagagtacctaccattcctccaaacctggcaggaatccct
ggggggaaacctgcatactccttccacgttactgcagacggtcagatgcagcctgtccct
tttccccccgacgccctcatcggacccggaatcccccggcatgctcgccagatcaacacc
ctcaaccacggggaggtggtgtgcgctgtgaccatcagcaaccccacgagacacgtgtac
acaggcgggaagggctgcgtcaaggtctgggacatcagccaccctggcaataagagccct
gtctcccagctcgactgtctgaacagagacaattatatccgttcctgtaaattgctaccc
gatggctgcactctcatagtgggaggggaagccagtactttgtccatttgggacctggcg
gctccaaccccgcgcatcaaggcggagctgacgtcctcggcccccgcctgctacgccctg
gccatcagccccgattccaaggtctgcttctcatgctgcagcgacggcaacatcgctgtg
tgggatctgcacaaccagacactagtgaggcaattccagggccacacagacggagccagc
tgtattgacatttctaatgatggcaccaagctctggacgggtggtttggacaacacagtc
aggtcctgggacctgcgcgaggggcggcagctgcagcagcacgacttcacctcccagatc
ttctccctggggtactgccccaccggggagtggctggcagtgggcatggagagcagcaat
gtggaggtgctgcacgtgaacaagcctgacaagtaccagctgcacctgcatgagagctgc
gtgctgtccctgaaatttgcttactgtggtaaatggtttgtgagtactggaaaagataac
ctcctcaatgcttggcggaccccctatggagccagcatattccagtccaaagagtcctcg
tcagtgcttagctgtgacatctctgtggatgataagtacatagtcactggctcgggggac
aagaaggctacagtctatgaagtcatctactga

KEGG   Homo sapiens (human): 7089
Entry
7089              CDS       T01001                                 
Symbol
TLE2, ESG, ESG2, GRG2
Name
(RefSeq) TLE family member 2, transcriptional corepressor
  KO
K04497  groucho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7089 (TLE2)
   04330 Notch signaling pathway
    7089 (TLE2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7089 (TLE2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      7089 (TLE2)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 NBCH_WD40 HALZ
Other DBs
NCBI-GeneID: 7089
NCBI-ProteinID: NP_003251
OMIM: 601041
HGNC: 11838
Ensembl: ENSG00000065717
Vega: OTTHUMG00000180613
Pharos: Q04725(Tbio)
UniProt: Q04725
LinkDB
Position
19:complement(2997644..3047635)
AA seq 743 aa
MYPQGRHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHY
VMYYEMSYGLNIEMHKQAEIVKRLSGICAQIIPFLTQEHQQQVLQAVERAKQVTVGELNS
LIGQQLQPLSHHAPPVPLTPRPAGLVGGSATGLLALSGALAAQAQLAAAVKEDRAGVEAE
GSRVERAPSRSASPSPPESLVEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVD
EDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSPLPRAKELILNDLPASTPA
SKSCDSSPPQDASTPGPSSASHLCQLAAKPAPSTDSVALRSPLTLSSPFTTSFSLGSHST
LNGDLSVPSSYVSLHLSPQVSSSVVYGRSPVMAFESHPHLRGSSVSSSLPSIPGGKPAYS
FHVSADGQMQPVPFPSDALVGAGIPRHARQLHTLAHGEVVCAVTISGSTQHVYTGGKGCV
KVWDVGQPGAKTPVAQLDCLNRDNYIRSCKLLPDGRSLIVGGEASTLSIWDLAAPTPRIK
AELTSSAPACYALAVSPDAKVCFSCCSDGNIVVWDLQNQTMVRQFQGHTDGASCIDISDY
GTRLWTGGLDNTVRCWDLREGRQLQQHDFSSQIFSLGHCPNQDWLAVGMESSNVEILHVR
KPEKYQLHLHESCVLSLKFASCGRWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDI
SRNNKYIVTGSGDKKATVYEVVY
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgtacccccagggaaggcacccgaccccgctccagtccggccagcccttcaagttctcg
atcttggagatctgcgaccgcatcaaagaagaattccagtttcttcaggctcaataccac
agcctcaagctagaatgtgagaagctggccagcgagaagacggaaatgcagcgacattat
gtcatgtattatgagatgtcgtacgggctcaacattgaaatgcataagcaggcggagatt
gtgaagcgtctgagcggtatctgcgctcagattatccccttcctgacccaggagcatcag
cagcaggtgctccaggccgtagaacgcgccaagcaggtcaccgtgggggagctgaacagc
ctcatcgggcagcagctccagccgctgtcccaccacgcaccccctgtgcccctcaccccc
cgcccagccgggctggtgggcggcagtgctacggggctgcttgctctgtctggagccctg
gctgcccaggctcagctggcggcggctgtcaaggaggaccgtgcgggcgtggaggccgag
gggtccagagtggagagagccccgagcaggagtgcatctccctcgccccctgagagtctc
gtggaggaggagcgaccgagtggccctggtggtggcgggaagcagagagcagatgagaag
gagccatcaggaccttatgaaagcgacgaagacaagagtgattacaatctggtggtggac
gaggaccaaccctcagagccccccagcccggctaccaccccctgcggaaaggtacccatc
tgcattcctgcccgtcgggacctggtggacagtccagcctccttggcctctagccttggc
tcaccgctgcctagagccaaggagctcatcctgaatgaccttcccgccagcactcctgcc
tccaaatcctgtgactcctccccgccccaggacgcttccacccccgggcccagctcggcc
agtcacctctgccagcttgctgccaagccagcaccttccacggacagcgtcgccctgagg
agccccctgactctgtccagtcccttcaccacgtccttcagcctgggctcccacagcact
ctcaacggagacctctccgtgcccagctcctacgtcagcctccacctgtccccccaggtc
agcagctctgtggtgtacggacgctcccccgtgatggcatttgagtctcatccccatctc
cgagggtcatccgtctcttcctccctacccagcatccctgggggaaagccggcctactcc
ttccacgtgtctgcggacgggcagatgcagccggttcccttcccctcggatgcactggta
ggcgcgggcatcccgcggcacgcccggcagctgcacacgctggcccatggcgaggtggtc
tgcgcggtcaccatcagcggctccacacagcatgtgtacacgggcggcaagggctgtgtg
aaggtgtgggacgtgggccagcctggggccaagacgcccgtggcccagctcgactgcctg
aaccgagacaactacattcgttcctgcaagttgctgccggatggccggagtctgatcgtg
ggcggtgaggccagcaccttgtccatttgggacctggcggcgcccaccccccgtatcaag
gccgagctgacttcctcagccccagcctgctacgccctggccgtcagccccgacgccaag
gtttgcttctcctgctgcagcgatggcaacattgtggtctgggacctgcagaatcagact
atggtcaggcagttccagggccacacggacggcgccagctgcattgatatttccgattac
ggcactcggctctggacagggggcctggacaacacggtgcgctgctgggacctgcgggag
ggccgccagctgcagcagcatgacttcagctcccagattttctccctgggccactgccct
aaccaggactggctggcggtcggaatggagagtagcaacgtggagatcctgcacgtccgc
aagccggagaaataccagctgcacctccacgagagctgcgtgctgtccctgaagtttgcc
tcctgcggacggtggtttgtgagcaccgggaaggacaacctgctcaacgcctggaggacg
ccgtacggggccagcattttccagtccaaggagtcgtcctcagtcctgagttgtgacatc
tccagaaataacaaatacatcgtgacaggctcgggggacaagaaggccaccgtgtatgag
gtggtctactga

KEGG   Homo sapiens (human): 7090
Entry
7090              CDS       T01001                                 
Symbol
TLE3, ESG, ESG3, GRG3, HsT18976
Name
(RefSeq) TLE family member 3, transcriptional corepressor
  KO
K04497  groucho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7090 (TLE3)
   04330 Notch signaling pathway
    7090 (TLE3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7090 (TLE3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      7090 (TLE3)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 NBCH_WD40 HALZ Ribosomal_S18
Other DBs
NCBI-GeneID: 7090
NCBI-ProteinID: NP_005069
OMIM: 600190
HGNC: 11839
Ensembl: ENSG00000140332
Vega: OTTHUMG00000172121
Pharos: Q04726(Tbio)
UniProt: Q04726
LinkDB
Position
15:complement(70047790..70097917)
AA seq 772 aa
MYPQGRHPAPHQPGQPGFKFTVAESCDRIKDEFQFLQAQYHSLKVEYDKLANEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTILAQIMPFLSQEHQQQVAQAVERAKQVTMTELN
AIIGQQQLQAQHLSHATHGPPVQLPPHPSGLQPPGIPPVTGSSSGLLALGALGSQAHLTV
KDEKNHHELDHRERESSANNSVSPSESLRASEKHRGSADYSMEAKKRKAEEKDSLSRYDS
DGDKSDDLVVDVSNEDPATPRVSPAHSPPENGLDKARSLKKDAPTSPASVASSSSTPSSK
TKDLGHNDKSSTPGLKSNTPTPRNDAPTPGTSTTPGLRSMPGKPPGMDPIGIMASALRTP
ISITSSYAAPFAMMSHHEMNGSLTSPGAYAGLHNIPPQMSAAAAAAAAAYGRSPMVSFGA
VGFDPHPPMRATGLPSSLASIPGGKPAYSFHVSADGQMQPVPFPHDALAGPGIPRHARQI
NTLSHGEVVCAVTISNPTRHVYTGGKGCVKIWDISQPGSKSPISQLDCLNRDNYIRSCKL
LPDGRTLIVGGEASTLTIWDLASPTPRIKAELTSSAPACYALAISPDAKVCFSCCSDGNI
AVWDLHNQTLVRQFQGHTDGASCIDISHDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTS
QIFSLGYCPTGEWLAVGMESSNVEVLHHTKPDKYQLHLHESCVLSLKFAYCGKWFVSTGK
DNLLNAWRTPYGASIFQSKESSSVLSCDISADDKYIVTGSGDKKATVYEVIY
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtatccgcagggcagacatccggctccccatcaacccgggcagccgggatttaaattc
acggtggctgagtcttgtgacaggatcaaagacgaattccagttcctgcaagctcagtat
cacagcctcaaagtggagtacgacaagctggcaaacgagaagacggagatgcagcgccat
tatgtgatgtactatgagatgtcctatggcttgaacattgaaatgcacaagcagacagag
attgcgaagagactgaacacaattttagcacagatcatgcctttcctgtcacaagagcac
cagcagcaggtggcgcaggcagtggagcgcgccaagcaggtcaccatgacggagctgaac
gccatcatcgggcagcagcagctccaggcgcagcacctctcccatgccacacacggcccc
ccggtccagttgccaccccacccgtcaggtctccagcctccaggaatccccccagtgaca
gggagcagctccgggctgctggcactgggcgccctgggcagccaggcccatctgacggtg
aaggatgagaagaaccaccatgaactcgatcacagagagagagaatccagtgcgaataac
tctgtgtcaccctcggaaagcctccgggccagtgagaagcaccggggctctgcggactac
agcatggaagccaagaagcggaaggcggaggagaaggacagcttgagccgatacgacagt
gatggagacaagagtgatgatctggtggtggatgtttccaatgaggaccccgcaacgccc
cgggtcagcccggcacactcccctcctgaaaatgggctggacaaggcccgtagcctgaaa
aaagatgcccccaccagccctgcctcggtggcctcttccagtagcacaccttcctccaag
accaaagaccttggtcataacgacaaatcctccacccctgggctcaagtccaacacacca
accccaaggaacgacgccccaactccaggcaccagcacgaccccagggctcaggtcgatg
ccgggtaaacctccgggcatggacccgataggtataatggcctcggctctgcgcacgccc
atctccatcaccagctcctatgcggcgcccttcgccatgatgagccaccatgagatgaac
ggctccctcaccagtcctggcgcctacgccggcctccacaacatcccaccccagatgagc
gccgccgccgctgctgcagccgctgcctatggccgatcgccaatggtgagctttggagct
gttggttttgaccctcaccccccgatgcgggccacaggcctcccctcaagcctggcctcc
attcctggaggaaaaccagcgtactcattccatgtgagtgctgatgggcagatgcagccc
gtgcccttcccccacgacgccctggcaggccccggcatcccgaggcacgcccggcagatc
aacacactcagccacggggaggtggtgtgtgccgtgaccatcagcaaccccacgaggcac
gtctacacaggtggcaagggctgcgtgaagatctgggacatcagccagccaggcagcaag
agccccatctcccagctggactgcctgaacagggacaattacatccgctcctgcaagctg
ctccctgatgggcgcacgctcatcgtgggcggcgaggccagcacgctcaccatctgggac
ctggcctcgcccacgccccgcatcaaggccgagctgacgtcctcggctcccgcctgttat
gccctggccattagccctgacgccaaagtctgcttctcctgctgcagcgatgggaacatt
gctgtctgggacctgcacaaccagaccctggtcaggcagttccagggccacacagatggg
gccagctgcatagacatctcccatgatggcaccaaactgtggacagggggcctggacaac
acggtgcgctcctgggacctgcgggagggccgacagctacagcagcatgacttcacttcc
cagatcttctcgctgggctactgccccactggggagtggctggctgtgggcatggagagc
agcaacgtggaggtgctgcaccacaccaagcctgacaagtaccagctgcacctgcacgag
agctgcgtgctctccctcaagttcgcctactgcggcaagtggttcgtgagcactgggaaa
gataaccttctcaacgcctggaggacgccttatggagccagcatattccagtctaaagaa
tcctcgtctgtcttgagttgtgacatttcagcggatgacaaatacattgtaacaggctct
ggtgacaagaaggccacagtttatgaggtcatctactaa

KEGG   Homo sapiens (human): 7091
Entry
7091              CDS       T01001                                 
Symbol
TLE4, BCE-1, BCE1, E(spI), E(spl), ESG, ESG4, GRG4, Grg-4
Name
(RefSeq) TLE family member 4, transcriptional corepressor
  KO
K04497  groucho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7091 (TLE4)
   04330 Notch signaling pathway
    7091 (TLE4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7091 (TLE4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      7091 (TLE4)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 NBCH_WD40 HALZ DUF4662
Other DBs
NCBI-GeneID: 7091
NCBI-ProteinID: NP_008936
OMIM: 605132
HGNC: 11840
Ensembl: ENSG00000106829
Vega: OTTHUMG00000020072
Pharos: Q04727(Tbio)
UniProt: Q04727
LinkDB
Position
9:79571965..79726882
AA seq 773 aa
MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEK
TEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQV
TMAELNAIIGQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQS
HLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIA
ARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASIASSS
STPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSL
RTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSP
VVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQ
INTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCR
LLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN
IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFT
SQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTG
KDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgattcgcgacctgagcaagatgtacccgcagaccagacacccagcaccgcatcagcct
gctcaaccctttaaatttacaatttccgaatcctgtgatcggattaaggaagagtttcag
tttttacaggctcaataccacagtctgaagctggaatgtgagaaactcgccagtgagaag
acagagatgcagcggcattatgtcatgtattatgaaatgtcctatgggttgaatatagaa
atgcacaagcaggcagagattgtcaagaggctgaatgctatctgtgcacaagtcattcct
ttcctgtcccaagagcaccagcaacaagtggtgcaggctgtggaacgggccaagcaggtg
accatggcagaactgaacgccatcattgggcaacaactccaggcccagcatttatcacat
ggacatggtctccccgtacctctgactccacacccttcagggctccagccccctgccatt
ccacccatcggtagcagtgccgggcttctggccctctccagtgctctaggaggtcagtcc
catcttccaattaaagatgagaagaagcaccatgacaatgatcaccaaagagacagagac
tccatcaagagctcttcagtatccccatcagccagtttccgaggtgctgagaagcacaga
aactccgcagactactcctcagagagcaaaaagcagaaaactgaagaaaaggaaattgca
gctcgttatgacagcgatggtgagaaaagtgatgacaacttggtggttgacgtttccaat
gaggatccatcttcccctcgagggagcccagcacattcccccagagagaatggcctagac
aagacacgcctgctcaagaaagatgccccgattagtccagcctctattgcatcttccagc
agtactccctcctccaaatccaaagaacttagccttaatgaaaaatctactactcccgtc
tcaaagtccaatacccctactccacgaactgatgcgcccaccccaggcagtaactctact
cccggattgaggcctgtacctggaaaaccaccaggagttgaccctttggcctcaagccta
aggaccccaatggcagtaccttgtccatatccaactccatttgggattgtgccccatgct
ggaatgaacggagagctgaccagccccggagcggcctacgctgggctccacaacatctcc
cctcagatgagcgcagctgctgccgccgccgctgctgctgctgcctatgggagatcacca
gtggtgggatttgatccacaccatcacatgcgtgtgccagcaatacctccaaacctgaca
ggcattccaggaggaaaaccagcatactccttccatgttagcgcagatggtcagatgcag
cctgtcccttttccacccgacgccctcatcggacctggaatcccccggcatgctcgccag
atcaacaccctcaaccacggggaggtggtgtgcgcggtgaccatcagcaaccccacgaga
cacgtgtacacgggtgggaagggctgcgtcaaggtctgggacatcagccacccaggcaat
aagagtcctgtctcccagctcgactgtctgaacagggataactacatccgttcctgcaga
ttgctccctgatggtcgcaccctaattgttggaggggaagccagtactttgtccatttgg
gacctggcggctccaaccccacgcatcaaggcagagctgacatcctcggcccccgcctgc
tatgccctggccatcagccccgattccaaggtctgcttctcatgctgcagcgacggcaac
atcgctgtgtgggatctgcacaaccagaccttggtgaggcaattccagggccacacagat
ggagccagctgtattgacatttctaatgatggcaccaagctctggacaggtggtttggac
aacacggtcaggtcctgggacctgcgcgaggggcggcagctgcagcagcacgacttcacc
tcccagatcttttctctgggctactgcccaactggagagtggcttgcagtggggatggag
aacagcaatgtggaagttttgcatgtcaccaagccagacaaataccaactacatcttcat
gagagctgtgtgctgtcgctcaagtttgcccattgtggcaaatggtttgtaagcactgga
aaggacaaccttctgaatgcctggagaacaccttatggggccagtatattccagtccaaa
gaatcctcatcggtgcttagctgtgacatctccgtggacgacaaatacattgtcactggc
tctggggataagaaggccacagtttatgaagttatttattaa

KEGG   Homo sapiens (human): 79816
Entry
79816             CDS       T01001                                 
Symbol
TLE6, GRG6, PREMBL
Name
(RefSeq) TLE family member 6, subcortical maternal complex member
  KO
K04497  groucho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
Disease
H02335  Preimplantation embryonic lethality
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    79816 (TLE6)
   04330 Notch signaling pathway
    79816 (TLE6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    79816 (TLE6)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      79816 (TLE6)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 79816
NCBI-ProteinID: NP_001137458
OMIM: 612399
HGNC: 30788
Ensembl: ENSG00000104953
Vega: OTTHUMG00000156793
Pharos: Q9H808(Tbio)
UniProt: Q9H808
LinkDB
Position
19:2977401..2995179
AA seq 572 aa
MTSRDQPRPKGPPKSTSPCPGISNSESSPTLNYQGILNRLKQFPRFSPHFAAELESIYYS
LHKIQQDVAEHHKQIGNVLQIVESCSQLQGFQSEEVSPAEPASPGTPQQVKDKTLQESSF
EDIMATRSSDWLRRPLGEDNQPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDEKAKPRDR
QQAPGLGQESKAPGSCDPGTDPCPEDASTPRPPEASSSPPEGSQDRNTSWGVVQEPPGRA
SRFLQSISWDPEDFEDAWKRPDALPGQSKRLAVPCKLEKMRILAHGELVLATAISSFTRH
VFTCGRRGIKVWSLTGQVAEDRFPESHLPIQTPGAFLRTCLLSSNSRSLLTGGYNLASVS
VWDLAAPSLHVKEQLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGY
PDGVKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQEDWVLLGMA
NGQQWLQSTSGSQRHMVGQKDSVILSVKFSPFGQWWASVGMDDFLGVYSMPAGTKVFEVP
EMSPVTCCDVSSNNRLVVTGSGEHASVYQITY
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgacctctagggaccagcccagacccaagggccccccgaaaagcacttcgccttgtcct
gggatctcgaactctgagagctctccgacgctgaattatcagggcattctaaatcggctc
aagcagttccccaggttttctcctcattttgctgcggagttggagagcatttactactcg
ctgcacaagatccagcaggatgtggcagaacatcacaagcagataggaaacgtcttacag
attgtggagagctgcagccaactccagggtttccagtctgaggaggtctcacctgctgaa
ccagccagccctgggacgccccagcaggtgaaggacaagaccctgcaggagtcgagcttt
gaggacatcatggccaccaggtcctccgactggctccggcggcctttgggggaggacaat
cagccggagacccagctgttctgggacaaggagccttggttttggcacgacactctgacc
gagcaactctggcggatttttgccggcgtccacgatgagaaggcaaagcccagagacaga
cagcaggcaccaggcctggggcaggaaagcaaggcaccaggatcctgtgacccaggaaca
gacccatgtcctgaagatgcctccacccccaggccacctgaggcctcctccagtccccct
gagggttcccaagacaggaacacaagttggggtgtggtccaggagcctcctggaagagcc
tctcggtttctacagtccatatcctgggaccctgaggactttgaagatgcatggaagagg
ccagatgccttgcccgggcagtcaaagagactcgccgtcccgtgcaaactggaaaagatg
cggatcttggcacacggggagctcgtgctcgccacggccatcagcagcttcacgcggcac
gtgttcacctgtggcagaagaggcatcaaggtgtggagcctgactggacaggtggctgag
gacaggttccctgagagccacctgcctatacagacccctggggccttcctgcgcacctgc
ctgctgtcctcaaacagcaggagcctgctcaccggtggctacaacctggccagcgtgagc
gtgtgggacctggcggcgccctccctgcatgtgaaggagcagttgccctgtgcaggtctc
aactgccaggccctggatgccaacctggatgccaacctggccttcgccagcttcaccagt
ggtgtggtcaggatctgggacctgcgggatcagagtgtggtcagggacctcaagggttat
cctgatggagtcaagagtatcgtggtcaagggctacaacatctggactgggggtccggat
gcctgtctgcggtgctgggaccagaggaccatcatgaaacctctggagtaccaattcaag
tctcagataatgagcctgtcccacagcccccaggaggactgggtgctgctgggcatggcc
aatggccagcagtggctgcaaagcaccagcgggagccagcggcacatggtggggcaaaaa
gacagcgtcatcctgagcgtcaagttctccccctttggccagtggtgggcaagcgttgga
atggacgacttccttggcgtctacagcatgccggcggggacaaaagtgttcgaggtgcct
gagatgtctccagtcacgtgctgtgacgtctcttccaacaaccgcctcgttgtcacaggc
tccggggagcacgcctccgtgtaccagatcacctactga

DBGET integrated database retrieval system