KEGG   Homo sapiens (human): 10286
Entry
10286             CDS       T01001                                 
Symbol
BCAS2, DAM1, SPF27, Snt309
Name
(RefSeq) BCAS2 pre-mRNA processing factor
  KO
K12861  pre-mRNA-splicing factor SPF27
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10286 (BCAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10286 (BCAS2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    10286 (BCAS2)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    10286 (BCAS2)
 Complex C
   Prp19-CDC5 complex
    10286 (BCAS2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    10286 (BCAS2)
SSDB
Motif
Pfam: BCAS2 HAUS2 THOC7 Tup_N CENP-F_leu_zip DUF4201 Uso1_p115_C
Other DBs
NCBI-GeneID: 10286
NCBI-ProteinID: NP_005863
OMIM: 605783
HGNC: 975
Ensembl: ENSG00000116752
Vega: OTTHUMG00000011898
Pharos: O75934(Tbio)
UniProt: O75934 B2R7W3
Structure
LinkDB
Position
1:complement(114567557..114581615)
AA seq 225 aa
MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSA
FETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVR
IENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLRE
MESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcgggcacaggtttggtggctggagaggttgtggtggatgcgctgccgtattttgat
caaggttatgaagcccctggtgtgcgggaagcggctgcagcgctggtggaggaggaaact
cgcagataccgacctactaagaactacctgagctacctgacagccccggattattctgcc
tttgaaactgacataatgagaaatgaatttgaaagactggctgctcgacaaccaattgaa
ttgctcagtatgaaacgatatgagcttccagccccctcctctggtcaaaaaaatgacatt
actgcatggcaagaatgtgtaaacaattctatggcccagttagagcatcaagcagttaga
attgagaatctggaactaatgtcacagcatggatgtaatgcctggaaagtatacaatgaa
aatctagttcatatgattgaacacgcacagaaggaacttcagaagttaagaaaacatatt
caagatttaaactggcagagaaagaacatgcaactcacagctggatctaaattgagagaa
atggagtcaaattgggtatccctggtcagtaagaattatgagattgaacggactattgtt
cagctagaaaatgaaatctatcaaattaagcagcaacatggagaggcaaacaaagaaaac
atccggcaagacttctga

DBGET integrated database retrieval system