KEGG   Homo sapiens (human): 10413
Entry
10413             CDS       T01001                                 

Gene name
YAP1, COB1, YAP, YAP2, YAP65, YKI
Definition
(RefSeq) Yes1 associated transcriptional regulator
  KO
K16687  transcriptional coactivator YAP1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Disease
H01114  Ocular coloboma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    10413 (YAP1)
   04392 Hippo signaling pathway - multiple species
    10413 (YAP1)
SSDB
Motif
Pfam: WW FAM181 MbtH
Other DBs
NCBI-GeneID: 10413
NCBI-ProteinID: NP_001123617
OMIM: 606608
HGNC: 16262
Ensembl: ENSG00000137693
Vega: OTTHUMG00000167322
Pharos: P46937(Tbio)
UniProt: P46937 Q86T74
LinkDB
Structure
PDB: 

Position
11q22.1
AA seq 504 aa
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGD
SETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTP
QHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMA
KTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS
NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGG
TQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSS
DILNDMESVLAATKLDKESFLTWL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggatcccgggcagcagccgccgcctcaaccggccccccagggccaagggcagccgcct
tcgcagcccccgcaggggcagggcccgccgtccggacccgggcaaccggcacccgcggcg
acccaggcggcgccgcaggcaccccccgccgggcatcagatcgtgcacgtccgcggggac
tcggagaccgacctggaggcgctcttcaacgccgtcatgaaccccaagacggccaacgtg
ccccagaccgtgcccatgaggctccggaagctgcccgactccttcttcaagccgccggag
cccaaatcccactcccgacaggccagtactgatgcaggcactgcaggagccctgactcca
cagcatgttcgagctcattcctctccagcttctctgcagttgggagctgtttctcctggg
acactgacccccactggagtagtctctggcccagcagctacacccacagctcagcatctt
cgacagtcttcttttgagatacctgatgatgtacctctgccagcaggttgggagatggca
aagacatcttctggtcagagatacttcttaaatcacatcgatcagacaacaacatggcag
gaccccaggaaggccatgctgtcccagatgaacgtcacagcccccaccagtccaccagtg
cagcagaatatgatgaactcggcttcaggtcctcttcctgatggatgggaacaagccatg
actcaggatggagaaatttactatataaaccataagaacaagaccacctcttggctagac
ccaaggcttgaccctcgttttgccatgaaccagagaatcagtcagagtgctccagtgaaa
cagccaccacccctggctccccagagcccacagggaggcgtcatgggtggcagcaactcc
aaccagcagcaacagatgcgactgcagcaactgcagatggagaaggagaggctgcggctg
aaacagcaagaactgcttcggcaggcaatgcggaatatcaatcccagcacagcaaattct
ccaaaatgtcaggagttagccctgcgtagccagttaccaacactggagcaggatggtggg
actcaaaatccagtgtcttctcccgggatgtctcaggaattgagaacaatgacgaccaat
agctcagatcctttccttaacagtggcacctatcactctcgagatgagagtacagacagt
ggactaagcatgagcagctacagtgtccctcgaaccccagatgacttcctgaacagtgtg
gatgagatggatacaggtgatactatcaaccaaagcaccctgccctcacagcagaaccgt
ttcccagactaccttgaagccattcctgggacaaatgtggaccttggaacactggaagga
gatggaatgaacatagaaggagaggagctgatgccaagtctgcaggaagctttgagttct
gacatccttaatgacatggagtctgttttggctgccaccaagctagataaagaaagcttt
cttacatggttatag

DBGET integrated database retrieval system