KEGG   Homo sapiens (human): 10413
Entry
10413             CDS       T01001                                 
Symbol
YAP1, COB1, YAP, YAP-1, YAP2, YAP65, YKI
Name
(RefSeq) Yes1 associated transcriptional regulator
  KO
K16687  transcriptional coactivator YAP1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Disease
H01114  Ocular coloboma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    10413 (YAP1)
   04392 Hippo signaling pathway - multiple species
    10413 (YAP1)
SSDB
Motif
Pfam: WW FAM181 MbtH
Other DBs
NCBI-GeneID: 10413
NCBI-ProteinID: NP_001123617
OMIM: 606608
HGNC: 16262
Ensembl: ENSG00000137693
Pharos: P46937(Tbio)
UniProt: P46937 Q86T74
Structure
LinkDB
Position
11:102110447..102233424
AA seq 504 aa
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGD
SETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTP
QHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMA
KTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNS
NQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGG
TQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSV
DEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSS
DILNDMESVLAATKLDKESFLTWL
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggatcccgggcagcagccgccgcctcaaccggccccccagggccaagggcagccgcct
tcgcagcccccgcaggggcagggcccgccgtccggacccgggcaaccggcacccgcggcg
acccaggcggcgccgcaggcaccccccgccgggcatcagatcgtgcacgtccgcggggac
tcggagaccgacctggaggcgctcttcaacgccgtcatgaaccccaagacggccaacgtg
ccccagaccgtgcccatgaggctccggaagctgcccgactccttcttcaagccgccggag
cccaaatcccactcccgacaggccagtactgatgcaggcactgcaggagccctgactcca
cagcatgttcgagctcattcctctccagcttctctgcagttgggagctgtttctcctggg
acactgacccccactggagtagtctctggcccagcagctacacccacagctcagcatctt
cgacagtcttcttttgagatacctgatgatgtacctctgccagcaggttgggagatggca
aagacatcttctggtcagagatacttcttaaatcacatcgatcagacaacaacatggcag
gaccccaggaaggccatgctgtcccagatgaacgtcacagcccccaccagtccaccagtg
cagcagaatatgatgaactcggcttcaggtcctcttcctgatggatgggaacaagccatg
actcaggatggagaaatttactatataaaccataagaacaagaccacctcttggctagac
ccaaggcttgaccctcgttttgccatgaaccagagaatcagtcagagtgctccagtgaaa
cagccaccacccctggctccccagagcccacagggaggcgtcatgggtggcagcaactcc
aaccagcagcaacagatgcgactgcagcaactgcagatggagaaggagaggctgcggctg
aaacagcaagaactgcttcggcaggcaatgcggaatatcaatcccagcacagcaaattct
ccaaaatgtcaggagttagccctgcgtagccagttaccaacactggagcaggatggtggg
actcaaaatccagtgtcttctcccgggatgtctcaggaattgagaacaatgacgaccaat
agctcagatcctttccttaacagtggcacctatcactctcgagatgagagtacagacagt
ggactaagcatgagcagctacagtgtccctcgaaccccagatgacttcctgaacagtgtg
gatgagatggatacaggtgatactatcaaccaaagcaccctgccctcacagcagaaccgt
ttcccagactaccttgaagccattcctgggacaaatgtggaccttggaacactggaagga
gatggaatgaacatagaaggagaggagctgatgccaagtctgcaggaagctttgagttct
gacatccttaatgacatggagtctgttttggctgccaccaagctagataaagaaagcttt
cttacatggttatag

DBGET integrated database retrieval system