KEGG   Homo sapiens (human): 1053
Entry
1053              CDS       T01001                                 

Symbol
CEBPE, C/EBP-epsilon, CRP1, c/EBP_epsilon
Name
(RefSeq) CCAAT enhancer binding protein epsilon
  KO
K10051  CCAAT/enhancer binding protein (C/EBP), epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00113  PML-RARA fusion to transcriptional repression
Disease
H00101  Other phagocyte defects
H02024  Neutrophil specific granule deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1053 (CEBPE)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1053 (CEBPE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1053 (CEBPE)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    1053 (CEBPE)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin Myc-LZ GAS UPF0449 Nmad5 DUF2605 DUF2514 Fib_alpha SBE2
Other DBs
NCBI-GeneID: 1053
NCBI-ProteinID: NP_001796
OMIM: 600749
HGNC: 1836
Ensembl: ENSG00000092067
Vega: OTTHUMG00000028719
Pharos: Q15744(Tbio)
UniProt: Q15744
LinkDB
Position
14q11.2
AA seq 281 aa
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV
KPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAV
KEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPC
SPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM
AENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtcccacgggacctactacgagtgtgagccccggggtggccagcagccactcgagttc
tcagggggccgagctgggcccggggagctaggggacatgtgtgagcatgaggcctccatt
gacctctccgcctacatcgagtctggggaagagcagcttctctccgatctctttgccgtg
aagccagcgcctgaggccagaggcctcaagggccccggaacccctgccttcccccactac
ttgccgcctgaccctcggccctttgcctaccctccacataccttcggcccagacaggaag
gcgctggggcctggcatctacagcagcccagggagctacgaccccagggctgtggcggtg
aaggaggagccccgggggccagagggcagccgagctgccagccgaggcagctacaatccc
ctgcagtaccaagtggcacactgtgggcagacagccatgcacctgcccccaactctggca
gcacccggccagcctctgcgcgttctcaaggcccctttggccactgccgcacccccctgc
agtcccctcctgaaggcgccctccccggctggccccttacacaagggcaagaaggcagtg
aacaaagatagccttgagtaccggctgaggcgggagcgcaacaacatcgccgtgcgcaag
agccgagacaaggccaagaggcgcattctggagacgcagcagaaggtgctggagtacatg
gcagagaacgagcgcctccgcagccgcgtggagcagctcacccaggagctagacaccctc
cgcaacctcttccgccagattcctgaggcggccaacctcatcaagggcgtggggggttgc
agctga

DBGET integrated database retrieval system