KEGG   Homo sapiens (human): 10664
Entry
10664             CDS       T01001                                 
Symbol
CTCF, CFAP108, FAP108, MRD21
Name
(RefSeq) CCCTC-binding factor
  KO
K23195  transcriptional repressor CTCF
Organism
hsa  Homo sapiens (human)
Network
nt06512  Chromosome cohesion and segregation
  Element
N01484  Establishment of cohesion
Disease
H00773  Autosomal dominant intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    10664 (CTCF)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10664 (CTCF)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    10664 (CTCF)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    10664 (CTCF)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zf-met zf-C2HE zf-C2H2_6 zf-WIZ
Other DBs
NCBI-GeneID: 10664
NCBI-ProteinID: NP_006556
OMIM: 604167
HGNC: 13723
Ensembl: ENSG00000102974
LinkDB
Position
16:67562526..67639185
AA seq 727 aa
MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQM
VMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV
PVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQ
GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV
NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG
RAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYAS
VEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDM
HFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKR
KMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTN
QPKQNQPTAIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEM
ILSMMDR
NT seq 2184 nt   +upstreamnt  +downstreamnt
atggaaggtgatgcagtcgaagccattgtggaggagtccgaaacttttattaaaggaaag
gagagaaagacttaccagagacgccgggaagggggccaggaagaagatgcctgccactta
ccccagaaccagacggatgggggtgaggtggtccaggatgtcaacagcagtgtacagatg
gtgatgatggaacagctggaccccacccttcttcagatgaagactgaagtaatggagggc
acagtggctccagaagcagaggctgctgtggacgatacccagattataactttacaggtt
gtaaatatggaggaacagcccataaacataggagaacttcagcttgttcaagtacctgtt
cctgtgactgtacctgttgctaccacttcagtagaagaacttcagggggcttatgaaaat
gaagtgtctaaagagggccttgcggaaagtgaacccatgatatgccacaccctacctttg
cctgaagggtttcaggtggttaaagtgggggccaatggagaggtggagacactagaacaa
ggggaacttccaccccaggaagatcctagttggcaaaaagacccagactatcagccacca
gccaaaaaaacaaagaaaaccaaaaagagcaaactgcgttatacagaggagggcaaagat
gtagatgtgtctgtctacgattttgaggaagaacagcaggagggtctgctatcagaggtt
aatgcagagaaagtggttggtaatatgaagcctccaaagccaacaaaaattaaaaagaaa
ggtgtaaagaagacattccagtgtgagctttgcagttacacgtgtccacggcgttcaaat
ttggatcgtcacatgaaaagccacactgatgagagaccacacaagtgccatctctgtggc
agggcattcagaacagtcaccctcctgaggaatcaccttaacacacacacaggtactcgt
cctcacaagtgcccagactgcgacatggcctttgtgaccagtggagaattggttcggcat
cgtcgttacaaacacacccacgagaagccattcaagtgttccatgtgcgattacgccagt
gtagaagtcagcaaattaaaacgtcacattcgctctcatactggagagcgtccgtttcag
tgcagtttgtgcagttatgccagcagggacacatacaagctgaaaaggcacatgagaacc
cattcaggggaaaagccttatgaatgttatatttgtcatgctcggtttacccaaagtggt
accatgaagatgcacattttacagaagcacacagaaaatgtggccaaatttcactgtccc
cactgtgacacagtcatagcccgaaaaagtgatttgggtgtccacttgcgaaagcagcat
tcctatattgagcaaggcaagaaatgccgttactgtgatgctgtgtttcatgagcgctat
gccctcatccagcatcagaagtcacacaagaatgagaagcgctttaagtgtgaccagtgt
gattacgcttgtagacaggagaggcacatgatcatgcacaagcgcacccacaccggggag
aagccttacgcctgcagccactgcgataagaccttccgccagaagcagcttctcgacatg
cacttcaagcgctatcacgaccccaacttcgtccctgcggcttttgtctgttctaagtgt
gggaaaacatttacacgtcggaataccatggcaagacatgctgataattgtgctggccca
gatggcgtagagggggaaaatggaggagaaacgaagaagagtaaacgtggaagaaaaaga
aagatgcgctctaagaaagaagattcctctgacagtgaaaatgctgaaccagatctggac
gacaatgaggatgaggaggagcctgccgtagaaattgaacctgagccagagcctcagcct
gtgaccccagccccaccacccgccaagaagcggagaggacgaccccctggcagaaccaac
cagcccaaacagaaccagccaacagctatcattcaggttgaagaccagaatacaggtgca
attgagaacattatagttgaagtaaaaaaagagccagatgctgagcccgcagagggagag
gaagaggaggcccagccagctgccacagatgcccccaacggagacctcacgcccgagatg
atcctcagcatgatggaccggtga

DBGET integrated database retrieval system