Homo sapiens (human): 10686 Help Entry 10686             CDS       T01001                                  Symbol CLDN16, HOMG3, PCLN1 Name (RefSeq) claudin 16   KO K06087   claudin Organism hsa  Homo sapiens (human) Pathway hsa03272   Virion - Hepatitis viruses hsa04382   Cornified envelope formation hsa04514   Cell adhesion molecules hsa04530   Tight junction hsa04670   Leukocyte transendothelial migration hsa05130   Pathogenic Escherichia coli infection hsa05160   Hepatitis C Network nt06180  Pathogenic Escherichia coli   Element N01287   Tight junction-Actin signaling pathway Disease H01210   Hypomagnesemia Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     10686 (CLDN16)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     10686 (CLDN16)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     10686 (CLDN16)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     10686 (CLDN16)   09158 Development and regeneration    04382 Cornified envelope formation     10686 (CLDN16)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     10686 (CLDN16)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     10686 (CLDN16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hsa03037]     10686 (CLDN16)    04147 Exosome [BR:hsa04147]     10686 (CLDN16)    04515 Cell adhesion molecules [BR:hsa04515]     10686 (CLDN16) Cilium and associated proteins [BR:hsa03037]  Other cilia and associated proteins   Stereociliary proteins    10686 (CLDN16) Exosome [BR:hsa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    10686 (CLDN16)   Exosomal proteins of colorectal cancer cells    10686 (CLDN16) Cell adhesion molecules [BR:hsa04515]  Immunoglobulin superfamily   L1 family    10686 (CLDN16) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Clc-like aGPT-Pplase3 DuoxA Motif Other DBs NCBI-GeneID:  10686 NCBI-ProteinID:  NP_006571 OMIM:  603959 HGNC:  2037 Ensembl:  ENSG00000113946 UniProt:  Q9Y5I7 LinkDB All DBs Position 3:190290361..190412138 Genome browser AA seq 235 aa AA seqDB search MRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRT CDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVA GATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAG AVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV NT seq 708 nt NT seq  +upstreamnt  +downstreamnt atgagggatcttcttcaatacatcgcttgcttctttgcctttttctctgctgggtttttg attgtggccacctggactgactgttggatggtgaatgctgatgactctctggaggtgagc acaaaatgccgaggcctctggtgggaatgcgtcacaaatgcttttgatgggattcgcacc tgtgatgagtacgattccatacttgcggagcatcccttgaagctggtggtaactcgagcg ttgatgattactgcagatattctagctgggtttggatttctcaccctgctccttggtctt gactgcgtgaaattcctccctgatgagccgtacattaaagtccgcatctgctttgttgct ggagccacgttactaatagcaggtaccccaggaatcattggctctgtgtggtatgctgtt gatgtgtatgtggaacgttctactttggttttgcacaatatatttcttggtatccaatat aaatttggttggtcctgttggctcggaatggctgggtctctgggttgctttttggctgga gctgttctcacctgctgcttatatctttttaaagatgttggacctgagagaaactatcct tattccttgaggaaagcctattcagccgcgggtgtttccatggccaagtcatactcagcc cctcgcacagagacggccaaaatgtatgctgtagacacaagggtgtaa

DBGET integrated database retrieval system