KEGG   Homo sapiens (human): 10878
Entry
10878             CDS       T01001                                 
Symbol
CFHR3, CFHL3, DOWN16, FHR-3, FHR3, HLF4
Name
(RefSeq) complement factor H related 3
  KO
K23815  complement factor H-related protein 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06513  Complement cascade
  Element
N01504  Regulation of complement cascade, CFHR
Disease
H00821  Age-related macular degeneration
H01434  Atypical hemolytic uremic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    10878 (CFHR3)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 10878
NCBI-ProteinID: NP_066303
OMIM: 605336
HGNC: 16980
Ensembl: ENSG00000116785
Pharos: Q02985(Tbio)
UniProt: Q02985
LinkDB
Position
1:196774840..196795407
AA seq 330 aa
MLLLINVILTLWVSCANGQVKPCDFPDIKHGGLFHENMRRPYFPVAVGKYYSYYCDEHFE
TPSGSYWDYIHCTQNGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGNSTEVACHPGYGL
PKAQTTVTCTEKGWSPTPRCIRVRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPGYA
TADGNSSGSITCLQNGWSAQPICINSSEKCGPPPPISNGDTTSFLLKVYVPQSRVEYQCQ
PYYELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNIKLKGRSDRKYYAKTGDTIEF
MCKLGYNANTSILSFQAVCREGIVEYPRCE
NT seq 993 nt   +upstreamnt  +downstreamnt
atgttgttactaatcaatgtcattctgaccttgtgggtttcctgtgctaatggacaagtg
aaaccttgtgattttccagacattaaacatggaggtctatttcatgagaatatgcgtaga
ccatactttccagtagctgtaggaaaatattactcctattactgtgatgaacattttgag
actccttcaggaagttactgggattacattcattgcacacaaaatgggtggtcaccagca
gtaccatgtctcagaaaatgttattttccttatttggaaaatggatataatcaaaattat
ggaagaaagtttgtacagggtaactctacagaagttgcctgccatcctggctacggtctt
ccaaaagcgcagaccacagttacatgtacggagaaaggctggtctcctactcccagatgc
atccgtgtcagaacatgctcaaaatcagatatagaaattgaaaatggattcatttccgaa
tcttcctctatttatattttaaataaagaaatacaatataaatgtaaaccaggatatgca
acagcagatggaaattcttcaggatcaattacatgtttgcaaaatggatggtcagcacaa
ccaatttgcattaattcttcagaaaagtgtgggcctcctccacctattagcaatggtgat
accacctcctttctactaaaagtgtatgtgccacagtcaagagtcgagtaccaatgccag
ccctactatgaacttcagggttctaattatgtaacatgtagtaatggagagtggtcggaa
ccaccaagatgcatacatccatgtataataactgaagaaaacatgaataaaaataacata
aagttaaaaggaagaagtgacagaaaatattatgcaaaaacaggggataccattgaattt
atgtgtaaattgggatataatgcaaatacatcaattctatcatttcaagcagtgtgtcgg
gaagggatagtggaataccccagatgcgaataa

KEGG   Homo sapiens (human): 3078
Entry
3078              CDS       T01001                                 
Symbol
CFHR1, CFHL, CFHL1, CFHL1P, CFHR1P, FHL-1, FHR-1, FHR1, H36, H36-1, H36-2, HFL1, HFL2
Name
(RefSeq) complement factor H related 1
  KO
K23815  complement factor H-related protein 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06513  Complement cascade
  Element
N01504  Regulation of complement cascade, CFHR
Disease
H00821  Age-related macular degeneration
H01434  Atypical hemolytic uremic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3078 (CFHR1)
SSDB
Motif
Pfam: Sushi Sushi_2
Other DBs
NCBI-GeneID: 3078
NCBI-ProteinID: NP_002104
OMIM: 134371
HGNC: 4888
Ensembl: ENSG00000244414
Pharos: Q03591(Tbio)
UniProt: Q03591
Structure
LinkDB
Position
1:196819731..196832189
AA seq 330 aa
MWLLVSVILISRISSVGGEATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRL
QNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPSGERVRYECRSPY
EMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNL
YQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVC
KRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtggctcctggtcagtgtaattctaatctcacggatatcctctgttgggggagaagca
acattttgtgattttccaaaaataaaccatggaattctatatgatgaagaaaaatataag
ccattttcccaggttcctacaggggaagttttctattactcctgtgaatataattttgtg
tctccttcaaaatcattttggactcgcataacatgcacagaagaaggatggtcaccaaca
ccaaagtgtctcagactgtgtttctttccttttgtggaaaatggtcattctgaatcttca
ggacaaacacatctggaaggtgatactgtgcaaattatttgcaacacaggatacagactt
caaaacaatgagaacaacatttcatgtgtagaacggggctggtccacccctcccaaatgc
aggtccactgacacttcctgtgtgaatccgcccacagtacaaaatgctcatatactgtcg
agacagatgagtaaatatccatctggtgagagagtacgttatgaatgtaggagcccttat
gaaatgtttggggatgaagaagtgatgtgtttaaatggaaactggacagaaccacctcaa
tgcaaagattctacgggaaaatgtgggccccctccacctattgacaatggggacattact
tcattcccgttgtcagtatatgctccagcttcatcagttgagtaccaatgccagaacttg
tatcaacttgagggtaacaagcgaataacatgtagaaatggacaatggtcagaaccacca
aaatgcttacatccgtgtgtaatatcccgagaaattatggaaaattataacatagcatta
aggtggacagccaaacagaagctttatttgagaacaggtgaatcagctgaatttgtgtgt
aaacggggatatcgtctttcatcacgttctcacacattgcgaacaacatgttgggatggg
aaactggagtatccaacttgtgcaaaaagatag

KEGG   Homo sapiens (human): 3080
Entry
3080              CDS       T01001                                 
Symbol
CFHR2, CFHL2, FHR2, HFL3
Name
(RefSeq) complement factor H related 2
  KO
K23815  complement factor H-related protein 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06513  Complement cascade
  Element
N01504  Regulation of complement cascade, CFHR
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3080 (CFHR2)
SSDB
Motif
Pfam: Sushi Sushi_2
Other DBs
NCBI-GeneID: 3080
NCBI-ProteinID: NP_005657
OMIM: 600889
HGNC: 4890
Ensembl: ENSG00000080910
Pharos: P36980(Tbio)
UniProt: P36980
Structure
LinkDB
Position
1:196943738..196959622
AA seq 270 aa
MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRL
QNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQN
LYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQKLYSRTGDIVEFV
CKSGYHPTKSHSFRAMCQNGKLVYPSCEEK
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtggctcctggtcagtgtaattctaatctcacggatatcctctgttgggggagaagca
atgttctgtgattttccaaaaataaaccatggaattctatatgatgaagaaaaatataag
ccattttcccaagttcctacaggggaagttttctattactcctgtgaatataattttgtg
tctccttcaaaatccttttggactcgcataacgtgcgcagaagaaggatggtcaccaaca
ccaaagtgtctcagactgtgtttctttccttttgtggaaaatggtcattctgaatcttca
ggacaaacacatctggaaggtgatactgtacaaattatttgcaacacaggatacagactt
caaaacaatgagaacaacatttcatgtgtagaacggggctggtccactcctcccaaatgc
aggtccactatttctgcagaaaaatgtgggccccctccacctattgacaatggagacatt
acttcattcctgttgtcagtatatgctccaggttcatcagttgagtaccagtgccagaac
ttgtatcaacttgagggtaacaatcaaataacatgtagaaacggacaatggtcagaacca
ccaaaatgcttagatccatgtgtaatatcacaagaaattatggaaaaatataacataaaa
ttaaagtggacaaaccaacaaaagctttattcaagaacaggtgacatagttgaatttgtt
tgtaaatctggatatcatccaacaaaatctcattcatttcgagcaatgtgtcagaatggg
aaactggtatatcccagttgtgaagaaaaatag

KEGG   Homo sapiens (human): 81494
Entry
81494             CDS       T01001                                 
Symbol
CFHR5, CFHL5, CFHR5D, FHR-5, FHR5
Name
(RefSeq) complement factor H related 5
  KO
K23817  complement factor H-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Network
nt06513  Complement cascade
  Element
N01504  Regulation of complement cascade, CFHR
Disease
H01726  Membranoproliferative glomerulonephritis
H02579  C3 glomerulopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    81494 (CFHR5)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 81494
NCBI-ProteinID: NP_110414
OMIM: 608593
HGNC: 24668
Ensembl: ENSG00000134389
Pharos: Q9BXR6(Tbio)
UniProt: Q9BXR6
LinkDB
Position
1:196975034..197009678
AA seq 569 aa
MLLLFSVILISWVSTVGGEGTLCDFPKIHHGFLYDEEDYNPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRMCSFPFVKNGHSESSGLIHLEGDTVQIICNTGYSL
QNNEKNISCVERGWSTPPICSFTKGECHVPILEANVDAQPKKESYKVGDVLKFSCRKNLI
RVGSDSVQCYQFGWSPNFPTCKGQVRSCGPPPQLSNGEVKEIRKEEYGHNEVVEYDCNPN
FIINGPKKIQCVDGEWTTLPTCVEQVKTCGYIPELEYGYVQPSVPPYQHGVSVEVNCRNE
YAMIGNNMITCINGIWTELPMCVATHQLKRCKIAGVNIKTLLKLSGKEFNHNSRIRYRCS
DIFRYRHSVCINGKWNPEVDCTEKREQFCPPPPQIPNAQNMTTTVNYQDGEKVAVLCKEN
YLLPEAKEIVCKDGRWQSLPRCVESTAYCGPPPSINNGDTTSFPLSVYPPGSTVTYRCQS
FYKLQGSVTVTCRNKQWSEPPRCLDPCVVSEENMNKNNIQLKWRNDGKLYAKTGDAVEFQ
CKFPHKAMISSPPFRAICQEGKFEYPICE
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgttgctcttattcagtgtaatcctaatctcatgggtatccactgttgggggagaagga
acactttgtgattttccaaaaatacaccatggatttctgtatgatgaagaagattataac
cctttttcccaagttcctacaggggaagttttctattactcctgtgaatataattttgtg
tctccttcaaaatccttttggactcgcataacatgcacagaagaaggatggtcaccaaca
ccgaagtgtctcagaatgtgttcctttccttttgtgaaaaatggtcattctgaatcttca
ggactaatacatctggaaggtgatactgtacaaattatttgcaacacaggatacagcctt
caaaacaatgagaaaaacatttcgtgtgtagaacggggctggtccactcctcccatatgc
agcttcactaaaggagaatgtcatgttccaattttagaagccaatgtagatgctcagcca
aaaaaagaaagctacaaagttggagacgtgttgaaattctcctgcagaaaaaatcttata
agagttggatcagactcagttcaatgttaccaatttgggtggtcacctaactttccaaca
tgcaaaggacaagtacgatcatgtggtccacctcctcaactctccaatggtgaagttaag
gagataagaaaagaggaatatggacacaatgaagtagtggaatatgattgcaatcctaat
tttataataaacgggcctaagaaaatacaatgtgtggatggagaatggacaactttaccc
acttgtgttgaacaagtgaaaacatgtggatacatacctgaactcgagtacggttatgtt
cagccgtctgtccctccctatcaacatggagtttcagtcgaggtgaattgcagaaatgaa
tatgcaatgattggaaataacatgattacctgtattaatggaatatggacagagcttcct
atgtgtgttgcaacacaccaacttaagaggtgcaaaatagcaggagttaatataaaaaca
ttactcaagctatctgggaaagaatttaatcataattctagaatacgttacagatgttca
gacatcttcagatacaggcactcagtctgtataaacgggaaatggaatcctgaagtagac
tgcacagaaaaaagggaacaattctgcccaccgccacctcagatacctaatgctcagaat
atgacaaccacagtgaattatcaggatggagaaaaagtagctgttctctgtaaagaaaac
tatctacttccagaagcaaaagaaattgtatgtaaagatggacgatggcaatcattacca
cgctgtgttgagtctactgcatattgtgggccccctccatctattaacaatggagatacc
acctcattcccattatcagtatatcctccagggtcaacagtgacgtaccgttgccagtcc
ttctataaactccagggctctgtaactgtaacatgcagaaataaacagtggtcagaacca
ccaagatgcctagatccatgtgtggtatctgaagaaaacatgaacaaaaataacatacag
ttaaaatggagaaacgatggaaaactctatgcaaaaacaggggatgctgttgaattccag
tgtaaattcccacataaagcgatgatatcatcaccaccatttcgagcaatctgtcaggaa
gggaaatttgaatatcctatatgtgaatga

DBGET integrated database retrieval system