KEGG   Homo sapiens (human): 10878
Entry
10878             CDS       T01001                                 

Gene name
CFHR3, CFHL3, DOWN16, FHR-3, FHR3, HLF4
Definition
(RefSeq) complement factor H related 3
  KO
K23815  complement factor H-related protein 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H00821  Age-related macular degeneration
H01434  Atypical hemolytic uremic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    10878 (CFHR3)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 10878
NCBI-ProteinID: NP_066303
OMIM: 605336
HGNC: 16980
Ensembl: ENSG00000116785
Vega: OTTHUMG00000035929
Pharos: Q02985(Tbio)
UniProt: Q02985
LinkDB
Position
1q31.3
AA seq 330 aa
MLLLINVILTLWVSCANGQVKPCDFPDIKHGGLFHENMRRPYFPVAVGKYYSYYCDEHFE
TPSGSYWDYIHCTQNGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGNSTEVACHPGYGL
PKAQTTVTCTEKGWSPTPRCIRVRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPGYA
TADGNSSGSITCLQNGWSAQPICINSSEKCGPPPPISNGDTTSFLLKVYVPQSRVEYQCQ
PYYELQGSNYVTCSNGEWSEPPRCIHPCIITEENMNKNNIKLKGRSDRKYYAKTGDTIEF
MCKLGYNANTSILSFQAVCREGIVEYPRCE
NT seq 993 nt   +upstreamnt  +downstreamnt
atgttgttactaatcaatgtcattctgaccttgtgggtttcctgtgctaatggacaagtg
aaaccttgtgattttccagacattaaacatggaggtctatttcatgagaatatgcgtaga
ccatactttccagtagctgtaggaaaatattactcctattactgtgatgaacattttgag
actccttcaggaagttactgggattacattcattgcacacaaaatgggtggtcaccagca
gtaccatgtctcagaaaatgttattttccttatttggaaaatggatataatcaaaattat
ggaagaaagtttgtacagggtaactctacagaagttgcctgccatcctggctacggtctt
ccaaaagcgcagaccacagttacatgtacggagaaaggctggtctcctactcccagatgc
atccgtgtcagaacatgctcaaaatcagatatagaaattgaaaatggattcatttccgaa
tcttcctctatttatattttaaataaagaaatacaatataaatgtaaaccaggatatgca
acagcagatggaaattcttcaggatcaattacatgtttgcaaaatggatggtcagcacaa
ccaatttgcattaattcttcagaaaagtgtgggcctcctccacctattagcaatggtgat
accacctcctttctactaaaagtgtatgtgccacagtcaagagtcgagtaccaatgccag
ccctactatgaacttcagggttctaattatgtaacatgtagtaatggagagtggtcggaa
ccaccaagatgcatacatccatgtataataactgaagaaaacatgaataaaaataacata
aagttaaaaggaagaagtgacagaaaatattatgcaaaaacaggggataccattgaattt
atgtgtaaattgggatataatgcaaatacatcaattctatcatttcaagcagtgtgtcgg
gaagggatagtggaataccccagatgcgaataa

KEGG   Homo sapiens (human): 3078
Entry
3078              CDS       T01001                                 

Gene name
CFHR1, CFHL, CFHL1, CFHL1P, CFHR1P, FHR-1, FHR1, H36, H36-1, H36-2, HFL1, HFL2
Definition
(RefSeq) complement factor H related 1
  KO
K23815  complement factor H-related protein 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H00821  Age-related macular degeneration
H01434  Atypical hemolytic uremic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3078 (CFHR1)
SSDB
Motif
Pfam: Sushi Sushi_2
Other DBs
NCBI-GeneID: 3078
NCBI-ProteinID: NP_002104
OMIM: 134371
HGNC: 4888
Ensembl: ENSG00000244414
Vega: OTTHUMG00000036276
Pharos: Q03591(Tbio)
UniProt: Q03591
LinkDB
Structure
PDB: 
3ZD2 3RJ3 4MUC 5WTB

Position
1q31.3
AA seq 330 aa
MWLLVSVILISRISSVGGEATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRL
QNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYPSGERVRYECRSPY
EMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPIDNGDITSFPLSVYAPASSVEYQCQNL
YQLEGNKRITCRNGQWSEPPKCLHPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVC
KRGYRLSSRSHTLRTTCWDGKLEYPTCAKR
NT seq 993 nt   +upstreamnt  +downstreamnt
atgtggctcctggtcagtgtaattctaatctcacggatatcctctgttgggggagaagca
acattttgtgattttccaaaaataaaccatggaattctatatgatgaagaaaaatataag
ccattttcccaggttcctacaggggaagttttctattactcctgtgaatataattttgtg
tctccttcaaaatcattttggactcgcataacatgcacagaagaaggatggtcaccaaca
ccaaagtgtctcagactgtgtttctttccttttgtggaaaatggtcattctgaatcttca
ggacaaacacatctggaaggtgatactgtgcaaattatttgcaacacaggatacagactt
caaaacaatgagaacaacatttcatgtgtagaacggggctggtccacccctcccaaatgc
aggtccactgacacttcctgtgtgaatccgcccacagtacaaaatgctcatatactgtcg
agacagatgagtaaatatccatctggtgagagagtacgttatgaatgtaggagcccttat
gaaatgtttggggatgaagaagtgatgtgtttaaatggaaactggacagaaccacctcaa
tgcaaagattctacgggaaaatgtgggccccctccacctattgacaatggggacattact
tcattcccgttgtcagtatatgctccagcttcatcagttgagtaccaatgccagaacttg
tatcaacttgagggtaacaagcgaataacatgtagaaatggacaatggtcagaaccacca
aaatgcttacatccgtgtgtaatatcccgagaaattatggaaaattataacatagcatta
aggtggacagccaaacagaagctttatttgagaacaggtgaatcagctgaatttgtgtgt
aaacggggatatcgtctttcatcacgttctcacacattgcgaacaacatgttgggatggg
aaactggagtatccaacttgtgcaaaaagatag

KEGG   Homo sapiens (human): 3080
Entry
3080              CDS       T01001                                 

Gene name
CFHR2, CFHL2, FHR2, HFL3
Definition
(RefSeq) complement factor H related 2
  KO
K23815  complement factor H-related protein 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3080 (CFHR2)
SSDB
Motif
Pfam: Sushi Sushi_2
Other DBs
NCBI-GeneID: 3080
NCBI-ProteinID: NP_005657
OMIM: 600889
HGNC: 4890
Ensembl: ENSG00000080910
Vega: OTTHUMG00000036518
Pharos: P36980(Tbio)
UniProt: P36980
LinkDB
Structure
PDB: 
3ZD1

Position
1q31.3
AA seq 270 aa
MWLLVSVILISRISSVGGEAMFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCAEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGYRL
QNNENNISCVERGWSTPPKCRSTISAEKCGPPPPIDNGDITSFLLSVYAPGSSVEYQCQN
LYQLEGNNQITCRNGQWSEPPKCLDPCVISQEIMEKYNIKLKWTNQQKLYSRTGDIVEFV
CKSGYHPTKSHSFRAMCQNGKLVYPSCEEK
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtggctcctggtcagtgtaattctaatctcacggatatcctctgttgggggagaagca
atgttctgtgattttccaaaaataaaccatggaattctatatgatgaagaaaaatataag
ccattttcccaagttcctacaggggaagttttctattactcctgtgaatataattttgtg
tctccttcaaaatccttttggactcgcataacgtgcgcagaagaaggatggtcaccaaca
ccaaagtgtctcagactgtgtttctttccttttgtggaaaatggtcattctgaatcttca
ggacaaacacatctggaaggtgatactgtacaaattatttgcaacacaggatacagactt
caaaacaatgagaacaacatttcatgtgtagaacggggctggtccactcctcccaaatgc
aggtccactatttctgcagaaaaatgtgggccccctccacctattgacaatggagacatt
acttcattcctgttgtcagtatatgctccaggttcatcagttgagtaccagtgccagaac
ttgtatcaacttgagggtaacaatcaaataacatgtagaaacggacaatggtcagaacca
ccaaaatgcttagatccatgtgtaatatcacaagaaattatggaaaaatataacataaaa
ttaaagtggacaaaccaacaaaagctttattcaagaacaggtgacatagttgaatttgtt
tgtaaatctggatatcatccaacaaaatctcattcatttcgagcaatgtgtcagaatggg
aaactggtatatcccagttgtgaagaaaaatag

KEGG   Homo sapiens (human): 81494
Entry
81494             CDS       T01001                                 

Gene name
CFHR5, CFHL5, CFHR5D, FHR-5, FHR5
Definition
(RefSeq) complement factor H related 5
  KO
K23817  complement factor H-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Disease
H01726  Membranoproliferative glomerulonephritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    81494 (CFHR5)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 81494
NCBI-ProteinID: NP_110414
OMIM: 608593
HGNC: 24668
Ensembl: ENSG00000134389
Vega: OTTHUMG00000036517
Pharos: Q9BXR6(Tbio)
UniProt: Q9BXR6
LinkDB
Position
1q31.3
AA seq 569 aa
MLLLFSVILISWVSTVGGEGTLCDFPKIHHGFLYDEEDYNPFSQVPTGEVFYYSCEYNFV
SPSKSFWTRITCTEEGWSPTPKCLRMCSFPFVKNGHSESSGLIHLEGDTVQIICNTGYSL
QNNEKNISCVERGWSTPPICSFTKGECHVPILEANVDAQPKKESYKVGDVLKFSCRKNLI
RVGSDSVQCYQFGWSPNFPTCKGQVRSCGPPPQLSNGEVKEIRKEEYGHNEVVEYDCNPN
FIINGPKKIQCVDGEWTTLPTCVEQVKTCGYIPELEYGYVQPSVPPYQHGVSVEVNCRNE
YAMIGNNMITCINGIWTELPMCVATHQLKRCKIAGVNIKTLLKLSGKEFNHNSRIRYRCS
DIFRYRHSVCINGKWNPEVDCTEKREQFCPPPPQIPNAQNMTTTVNYQDGEKVAVLCKEN
YLLPEAKEIVCKDGRWQSLPRCVESTAYCGPPPSINNGDTTSFPLSVYPPGSTVTYRCQS
FYKLQGSVTVTCRNKQWSEPPRCLDPCVVSEENMNKNNIQLKWRNDGKLYAKTGDAVEFQ
CKFPHKAMISSPPFRAICQEGKFEYPICE
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgttgctcttattcagtgtaatcctaatctcatgggtatccactgttgggggagaagga
acactttgtgattttccaaaaatacaccatggatttctgtatgatgaagaagattataac
cctttttcccaagttcctacaggggaagttttctattactcctgtgaatataattttgtg
tctccttcaaaatccttttggactcgcataacatgcacagaagaaggatggtcaccaaca
ccgaagtgtctcagaatgtgttcctttccttttgtgaaaaatggtcattctgaatcttca
ggactaatacatctggaaggtgatactgtacaaattatttgcaacacaggatacagcctt
caaaacaatgagaaaaacatttcgtgtgtagaacggggctggtccactcctcccatatgc
agcttcactaaaggagaatgtcatgttccaattttagaagccaatgtagatgctcagcca
aaaaaagaaagctacaaagttggagacgtgttgaaattctcctgcagaaaaaatcttata
agagttggatcagactcagttcaatgttaccaatttgggtggtcacctaactttccaaca
tgcaaaggacaagtacgatcatgtggtccacctcctcaactctccaatggtgaagttaag
gagataagaaaagaggaatatggacacaatgaagtagtggaatatgattgcaatcctaat
tttataataaacgggcctaagaaaatacaatgtgtggatggagaatggacaactttaccc
acttgtgttgaacaagtgaaaacatgtggatacatacctgaactcgagtacggttatgtt
cagccgtctgtccctccctatcaacatggagtttcagtcgaggtgaattgcagaaatgaa
tatgcaatgattggaaataacatgattacctgtattaatggaatatggacagagcttcct
atgtgtgttgcaacacaccaacttaagaggtgcaaaatagcaggagttaatataaaaaca
ttactcaagctatctgggaaagaatttaatcataattctagaatacgttacagatgttca
gacatcttcagatacaggcactcagtctgtataaacgggaaatggaatcctgaagtagac
tgcacagaaaaaagggaacaattctgcccaccgccacctcagatacctaatgctcagaat
atgacaaccacagtgaattatcaggatggagaaaaagtagctgttctctgtaaagaaaac
tatctacttccagaagcaaaagaaattgtatgtaaagatggacgatggcaatcattacca
cgctgtgttgagtctactgcatattgtgggccccctccatctattaacaatggagatacc
acctcattcccattatcagtatatcctccagggtcaacagtgacgtaccgttgccagtcc
ttctataaactccagggctctgtaactgtaacatgcagaaataaacagtggtcagaacca
ccaagatgcctagatccatgtgtggtatctgaagaaaacatgaacaaaaataacatacag
ttaaaatggagaaacgatggaaaactctatgcaaaaacaggggatgctgttgaattccag
tgtaaattcccacataaagcgatgatatcatcaccaccatttcgagcaatctgtcaggaa
gggaaatttgaatatcctatatgtgaatga

DBGET integrated database retrieval system