KEGG   Homo sapiens (human): 10907
Entry
10907             CDS       T01001                                 
Symbol
TXNL4A, BMKS, DIB1, DIM1, SNRNP15, TXNL4, U5-15kD
Name
(RefSeq) thioredoxin like 4A
  KO
K12859  U5 snRNP protein, DIM1 family
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H01839  Burn-McKeown syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    10907 (TXNL4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    10907 (TXNL4A)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    10907 (TXNL4A)
SSDB
Motif
Pfam: DIM1 Thioredoxin Thioredoxin_8 Thioredoxin_7
Other DBs
NCBI-GeneID: 10907
NCBI-ProteinID: NP_006692
OMIM: 611595
HGNC: 30551
Ensembl: ENSG00000141759
Pharos: P83876(Tdark)
UniProt: P83876
Structure
LinkDB
Position
18:complement(79970813..80033936)
AA seq 142 aa
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL
VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVY
RGARKGRGLVVSPKDYSTKYRY
NT seq 429 nt   +upstreamnt  +downstreamnt
atgtcgtacatgctcccgcacctgcacaacggctggcaggtggaccaggccatcctctcg
gaggaggaccgcgtggtcgtcatccgcttcggccacgactgggatcctacgtgcatgaag
atggacgaggtcctgtacagcatcgccgagaaggttaaaaattttgcagttatttatctt
gtggatattacagaagtgcctgacttcaacaaaatgtatgagttatacgatccatgtact
gtcatgtttttcttcaggaacaagcacatcatgattgacttggggactggcaacaacaac
aagattaactgggccatggaggacaagcaggagatggtggacatcatcgagacggtgtac
cgcggggcccgcaaaggccgcggcctggtggtgtcccccaaggactactccaccaagtac
cgctactga

DBGET integrated database retrieval system