KEGG   Homo sapiens (human): 1103
Entry
1103              CDS       T01001                                 
Symbol
CHAT, CHOACTASE, CMS1A, CMS1A2, CMS6
Name
(RefSeq) choline O-acetyltransferase
  KO
K00623  choline O-acetyltransferase [EC:2.3.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa04725  Cholinergic synapse
Disease
H00770  Congenital myasthenic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    1103 (CHAT)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1103 (CHAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.6  choline O-acetyltransferase
     1103 (CHAT)
SSDB
Motif
Pfam: Carn_acyltransf
Other DBs
NCBI-GeneID: 1103
NCBI-ProteinID: NP_065574
OMIM: 118490
HGNC: 1912
Ensembl: ENSG00000070748
Pharos: P28329(Tchem)
UniProt: P28329
Structure
LinkDB
Position
10:49609095..49667942
AA seq 748 aa
MGLRTAKKRGLGGGGKWKREEGGGTRGRREVRPACFLQSGGRGDPGDVGGPAGNPGCSPH
PRAATRPPPLPAHTPAHTPEWCGAASAEAAEPRRAGPHLCIPAPGLTKTPILEKVPRKMA
AKTPSSEESGLPKLPVPPLQQTLATYLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQ
QKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLIS
GVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPE
PEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSE
WAEARTVLVKDSTNRDSLDMIERCICLVCLDAPGGVELSDTHRALQLLHGGGYSKNGANR
WYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQSSRKLIRADSVSELPAP
RRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQ
LAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLL
KDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQV
PTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRD
LCSLLPPTESKPLATKEKATRPSQGHQP
NT seq 2247 nt   +upstreamnt  +downstreamnt
atggggctgaggacagcgaagaagagggggcttgggggaggggggaaatggaagagagag
gagggaggaggtacaagaggaaggagagaagtgcggccagcttgctttctccagtcgggt
ggccgcggggacccgggcgacgtcggaggccctgccgggaacccaggctgcagcccccac
ccccgcgctgcgacacgccccccaccccttccggctcacacccccgcccacactcctgag
tggtgcggtgcagcgtcggccgaggcagcagagccgaggagagcaggtccacacctctgc
atccctgcaccaggactcaccaagacgcccatcctggaaaaggtcccccgtaagatggca
gcaaaaactcccagcagtgaggagtctgggctgcccaaactgcccgtgcccccgctgcag
cagaccctggccacgtacctgcagtgcatgcgacacttggtgtctgaggagcagttcagg
aagagccaggccattgtgcagcagtttggggcccctggtggcctcggcgagaccctgcag
cagaaactcctggagcggcaggagaagacagccaactgggtgtctgagtactggctgaat
gacatgtatctcaacaaccgcctggccctgcctgtcaactccagccctgccgtgatcttt
gctcggcagcacttccctggcaccgatgaccagctgaggtttgcagccagcctcatctct
ggtgtactcagctacaaggccctgctggacagccactccattcccactgactgtgccaaa
ggccagctgtcagggcagcccctttgcatgaagcaatactatgggctcttctcctcctac
cggctccccggccatacccaggacacgctggtggctcagaacagcagcatcatgccggag
cctgagcacgtcatcgtagcctgctgcaatcagttctttgtcttggatgttgtcattaat
ttccgccgtctcagtgagggggatctgttcactcagttgagaaagatagtcaaaatggct
tccaacgaggacgagcgtttgcctccaattggcctgctgacgtctgacgggaggagcgag
tgggccgaggccaggacggtcctcgtgaaagactccaccaaccgggactcgctggacatg
attgagcgctgcatctgccttgtatgcctggacgcgccaggaggcgtggagctcagcgac
acccacagggcactccagctccttcacggcggaggctacagcaagaacggggccaatcgc
tggtacgacaagtccctgcagtttgtggtgggccgagacggcacctgcggtgtggtgtgc
gaacactccccattcgatggcatcgtcctggtgcagtgcactgagcatctgctcaagcac
gtgacgcagagcagcaggaagctgatccgagcagactccgtcagcgagctccccgccccc
cggaggctgcggtggaaatgctccccggaaattcaaggccacttagcctcctcggcagaa
aaacttcaacgaatagtaaagaaccttgacttcattgtctataagtttgacaactatggg
aaaacattcattaagaagcagaaatgcagccctgatgccttcatccaggtggccctccag
ctggccttctacaggctccatcgaagactggtgcccacctacgagagcgcgtccatccgc
cgattccaggagggacgcgtggacaacatcagatcggccactccagaggcactggctttt
gtgagagccgtgactgaccacaaggctgctgtgccagcttctgagaagcttctgctcctg
aaggatgccatccgtgcccagactgcatacacagtcatggccataacagggatggccatt
gacaaccacctgctggcactgcgggagctggcccgggccatgtgcaaggagctgcccgag
atgttcatggatgaaacctacctgatgagcaaccggtttgtcctctccactagccaggtg
cccacaaccacggagatgttctgctgctatggtcctgtggtcccaaatgggtatggtgcc
tgctacaacccccagccagagaccatccttttctgcatctctagctttcacagctgcaaa
gagacttcttctagcaagtttgcaaaagctgtggaagaaagcctcattgacatgagagac
ctctgcagtctgctgccgcctactgagagcaagccattggcaacaaaggaaaaagccacg
aggcccagccagggacaccaaccttga

DBGET integrated database retrieval system