KEGG   Homo sapiens (human): 11269
Entry
11269             CDS       T01001                                 
Symbol
DDX19B, DBP5, DDX19, RNAh
Name
(RefSeq) DEAD-box helicase 19B
  KO
K18655  ATP-dependent RNA helicase DDX19/DBP5 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    11269 (DDX19B)
   03015 mRNA surveillance pathway
    11269 (DDX19B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    11269 (DDX19B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     11269 (DDX19B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     11269 (DDX19B)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 11269
NCBI-ProteinID: NP_009173
OMIM: 605812
HGNC: 2742
Ensembl: ENSG00000157349
Vega: OTTHUMG00000137577
Pharos: Q9UMR2(Tbio)
UniProt: Q9UMR2 A0A0U4B4U6
Structure
LinkDB
Position
16:70289767..70335305
AA seq 479 aa
MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQS
LLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQE
NALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGK
VIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFV
LDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKRE
EETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQV
ALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDN
ETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggccactgactcatgggccctggcggtggacgagcaggaagctgcggctgagtcgttg
agcaacttgcatcttaaggaagagaaaatcaaaccagataccaatggtgctgttgtcaag
accaatgccaatgcagagaagacagatgaagaagagaaagaggacagagctgcccagtcc
ttactcaacaagctgatcagaagcaaccttgttgataacacaaaccaagtggaagtcctg
cagcgggatccaaactcccctctgtactcggtgaagtcttttgaagagcttcggctgaaa
ccacagcttctccaaggagtctatgccatgggtttcaatcgtccatccaagatacaagag
aacgcattgccactgatgcttgctgagcccccacagaacttaattgcccaatctcagtct
ggtactggtaaaacagctgccttcgtgctggccatgcttagccaagtagaacctgcaaac
aaatacccccagtgtctatgtctctccccaacgtatgagctcgccctccaaacaggaaaa
gtgattgaacaaatgggcaaattttaccctgaactgaagctagcttatgctgttcgaggc
aataaattggaaagaggccagaagatcagtgagcagattgtcattggcacccctgggact
gtgctggactggtgctccaagctcaagttcattgatcccaagaaaatcaaggtgtttgtt
ctggatgaggctgatgtcatgatagccactcagggccaccaagatcagagcatccgcatc
cagaggatgctgcccaggaactgccagatgctgcttttctccgccacctttgaagactct
gtgtggaagtttgcccagaaagtggtcccagacccaaacgttatcaaactgaagcgtgag
gaagagaccctggacaccatcaagcagtactatgtcctgtgcagcagcagagacgagaag
ttccaggccttgtgtaacctctacggggccatcaccattgctcaagccatgatcttctgc
catactcgcaaaacagctagttggctggcagcagagctctcaaaagaaggccaccaggtg
gctctgctgagtggggagatgatggtggaacagagggctgcagtgattgagcgcttccga
gagggcaaagagaaggttttggtgaccaccaacgtgtgtgcccgcggcattgatgttgaa
caagtgtctgtcgtcatcaactttgatcttcccgtggacaaggacgggaatcctgacaat
gagacctacctgcaccggatcgggcgcacgggccgctttggcaagaggggcctggcagtg
aacatggtggacagcaagcacagcatgaacatcctgaacagaatccaggagcattttaat
aagaagatagaaagattggacacagatgatttggacgagattgagaaaatagccaactga

DBGET integrated database retrieval system