KEGG   Homo sapiens (human): 114799
Entry
114799            CDS       T01001                                 
Symbol
ESCO1, A930014I12Rik, CTF, ECO1, EFO1, ESO1
Name
(RefSeq) establishment of sister chromatid cohesion N-acetyltransferase 1
  KO
K11268  N-acetyltransferase [EC:2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Network
nt06512  Chromosome cohesion and segregation
  Element
N01483  Cohesin acetylation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    114799 (ESCO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    114799 (ESCO1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Adherin complex
    114799 (ESCO1)
SSDB
Motif
Pfam: Acetyltransf_13 zf-C2H2_3
Other DBs
NCBI-GeneID: 114799
NCBI-ProteinID: NP_443143
OMIM: 609674
HGNC: 24645
Ensembl: ENSG00000141446
UniProt: Q5FWF5
LinkDB
Position
18:complement(21529284..21600704)
AA seq 840 aa
MMSIQEKSKENSSKVTKKSDDKNSETEIQDSQKNLAKKSGPKETIKSQAKSSSESKINQP
ELETRMSTRSSKAASNDKATKSINKNTVTVRGYSQESTKKKLSQKKLVHENPKANEQLNR
RSQRLQQLTEVSRRSLRSREIQGQVQAVKQSLPPTKKEQCSSTQSKSNKTSQKHVKRKVL
EVKSDSKEDENLVINEVINSPKGKKRKVEHQTACACSSQCTQGSEKCPQKTTRRDETKPV
PVTSEVKRSKMATSVVPKKNEMKKSVHTQVNTNTTLPKSPQPSVPEQSDNELEQAGKSKR
GSILQLCEEIAGEIESDNVEVKKESSQMESVKEEKPTEIKLEETSVERQILHQKETNQDV
QCNRFFPSRKTKPVKCILNGINSSAKKNSNWTKIKLSKFNSVQHNKLDSQVSPKLGLLRT
SFSPPALEMHHPVTQSTFLGTKLHDRNITCQQEKMKEINSEEVKINDITVEINKTTERAP
ENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKI
DTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEITIPKDLKLKEAEKT
DEKQLIIDAGQKRFGAVSCNVCGMLYTASNPEDETQHLLFHNQFISAVKYVGWKKERILA
EYPDGRIIMVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVG
CLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRR
KKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgatgtccattcaggagaaatcaaaagagaattcctccaaagttactaaaaaaagtgac
gataagaattcagaaacagaaattcaggattctcaaaagaatctagcaaaaaaatcaggt
ccaaaggagactataaaatcacaggctaaatcttccagtgaaagtaaaataaatcagcca
gaattggaaacacgcatgagtacaaggtcatcaaaggcagcatctaatgataaagctact
aaatccattaataaaaatacggtgactgtgaggggatattcacaagaatctacaaaaaag
aaattatctcagaaaaaattagtacatgaaaaccctaaagcaaatgaacagcttaaccgg
agatcacaaaggctacaacaattaacagaggtttcaagaaggtcgttacgcagtagagaa
attcagggtcaagttcaagcagttaaacagagtttgccaccaactaaaaaagagcagtgt
agcagtactcagagtaaatctaataaaacaagtcaaaaacatgtgaagagaaaagtactg
gaagtaaagtctgactctaaagaagatgaaaatctagtaattaatgaagtaataaattct
cccaaagggaaaaaacgcaaggtagaacatcagacagcttgtgcttgtagttctcaatgc
acgcaaggatctgaaaagtgtcctcagaagactactagaagagacgaaacgaaacctgtg
cctgtaacttctgaggtgaaaagatcaaaaatggctacttcagtggtcccgaaaaagaat
gagatgaagaagtcggttcatacacaagtgaatactaacacaacactcccaaaaagtcca
cagccatcagtgcctgaacaaagtgataatgagctggagcaagcaggaaagagcaaacga
ggtagtattctccagctctgtgaagaaattgctggtgaaattgagtcagataatgtagag
gtaaaaaaggaatcttcacaaatggaaagtgtaaaggaagaaaagcccacagaaataaaa
ttggaagagaccagtgttgaaagacaaatacttcatcagaaggaaacaaatcaggatgtg
caatgtaatcgttttttcccaagtagaaaaacaaagcctgtgaaatgtatactaaatgga
ataaacagctcagccaagaagaactccaactggactaaaattaaactctcaaaatttaac
tctgtgcagcacaataagttggactctcaagtttcccctaaattaggcttattacgaacc
agtttttcaccaccagctttagaaatgcatcatccagtgactcaaagtacgtttttaggg
acaaagctacatgatagaaatataacttgccagcaggaaaaaatgaaagaaattaattct
gaagaagtgaaaattaatgatattacagtagaaattaataaaaccacagaaagggctcct
gaaaattgtcatttggccaatgagataaaaccttctgacccaccattggataatcagatg
aaacattcttttgattcagcatcaaataagaatttcagccaatgtttggaatccaagcta
gaaaacagtccagtggaaaatgttactgctgcttcgactctgctcagtcaagcaaaaatt
gatacaggagagaataaatttccaggttcagctccccaacagcatagtattctcagtaac
cagacatctaaaagcagtgataacagggagacaccacgaaatcattctttgcctaagtgt
aattcccatttggagataacaattccaaaggacttgaaactaaaagaagcagagaaaact
gatgaaaaacagttgattatagatgcaggacaaaaaagatttggagcagtttcttgtaat
gtttgtggaatgctgtatacagcttcaaatccagaagatgaaacacagcatctgcttttc
cacaaccagtttataagtgctgttaaatatgtgggctggaagaaagaaagaattctggct
gaataccctgatggcaggataataatggttcttcctgaagacccaaagtatgccctgaaa
aaggttgacgagattagagagatggttgacaatgatttaggttttcaacaggctccacta
atgtgctattccagaactaaaacacttctcttcatttccaatgacaaaaaagtagttggc
tgcctaattgcggaacatatccaatggggctacagagttatagaagagaaacttccagtt
atcaggtcagaagaagaaaaagtcagatttgaaaggcaaaaagcctggtgctgctcaaca
ttaccagagcctgcaatctgcgggatcagtcgaatatgggtattcagcatgatgcgtcgg
aagaaaattgcttctcgcatgattgaatgcctaaggagtaactttatatatggctcatat
ttgagcaaagaagaaattgctttctcagatcccactcctgatggaaagctgtttgcaaca
cagtactgtggcactggtcaatttctggtatataattttattaatggacagaatagcacg
taa

DBGET integrated database retrieval system