KEGG   Homo sapiens (human): 115653
Entry
115653            CDS       T01001                                 
Symbol
KIR3DL3, CD158Z, KIR2DL5B, KIR3DL7, KIR44, KIRC1
Name
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    115653 (KIR3DL3)
   04612 Antigen processing and presentation
    115653 (KIR3DL3)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    115653 (KIR3DL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    115653 (KIR3DL3)
CD molecules [BR:hsa04090]
 Proteins
  115653 (KIR3DL3)
SSDB
Motif
Pfam: ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 115653
NCBI-ProteinID: NP_703144
OMIM: 610095
HGNC: 16312
Ensembl: ENSG00000242019
UniProt: A0A8I5QEB2
LinkDB
Position
19:54724442..54736632
AA seq 410 aa
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSL
SKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGV
HRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNY
SMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRAL
PHAWSDPSDPLPVSVTGNSRNLHVLIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEP
AGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQRPKTPPTDTSV
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctggaggggccctgg
ccacatgtgggtggtcaggacaagcccttcctctctgcctggcccggcactgtggtgtct
gaaggacaacatgtgactcttcagtgtcgctctcgtcttgggtttaatgaattcagtctg
tccaaagaagacgggatgcctgtccctgagctctacaacagaatattccggaacagcttt
ctcatgggccctgtgaccccagcacatgcagggacctacagatgttgcagttcacaccca
cactcccccactgggtggtcggcacccagcaaccctgtggtgatcatggtcacaggagtc
cacagaaaaccttccctcctggcccacccaggtcccctggtgaaatcaggagagacggtc
atcctgcaatgttggtcagatgtcaggtttgagcgcttccttctgcacagagaggggatc
actgaggaccccttgcgcctcgttggacagctccacgatgcgggttcccaggtcaactat
tccatgggtcccatgacacctgcccttgcagggacctacagatgctttggttctgtcact
cacttaccctatgagttgtcggctcccagtgaccctctggacatcgtggtcgtaggtcta
tatgggaaaccttctctctcagcccagccgggccccacggttcaggcaggagagaatgtg
accttgtcctgcagctcccggagcttgtttgacatttaccatctatccagggaggcggag
gccggtgaacttaggctcactgcagtgctgagggtcaatggaacattccaggccaacttc
cctctgggccctgtgacccacggagggaactacagatgcttcggctctttccgtgccctg
ccccatgcgtggtcagacccgagtgacccactgcccgtttctgtcacaggtaactccaga
aacctgcacgttctgattgggacctcagtggtcatcatcccctttgctatcctcctcttc
tttctccttcatcgctggtgtgccaacaaaaagaatgctgttgtaatggaccaagagcct
gcagggaacagaacagtgaacagggaggactctgatgaacaagaccctcaggaggtgaca
tacgcacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcagagg
cccaagacacccccaacagataccagcgtgtaa

KEGG   Homo sapiens (human): 3811
Entry
3811              CDS       T01001                                 
Symbol
KIR3DL1, CD158E1, KIR, KIR2DL5B, KIR3DL1/S1, NKAT-3, NKAT3, NKB1, NKB1B
Name
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 1
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Disease
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3811 (KIR3DL1)
   04612 Antigen processing and presentation
    3811 (KIR3DL1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3811 (KIR3DL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3811 (KIR3DL1)
CD molecules [BR:hsa04090]
 Proteins
  3811 (KIR3DL1)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 SIT MAP17
Other DBs
NCBI-GeneID: 3811
NCBI-ProteinID: NP_001309097
OMIM: 604946
HGNC: 6338
Ensembl: ENSG00000167633
Pharos: P43629(Tbio)
UniProt: P43629 Q8N6C9 Q6H2G3
Structure
LinkDB
Position
19:54816438..54830778
AA seq 444 aa
MLLMVVSMACVGFFLVQRAGPHVGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFML
YKEDRIHVPIFHGRLFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGN
HRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANF
SIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHS
PYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLL
HLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKT
PPTDTILYTELPNAKPRSKVVSCP
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgttgctcatggtcgtcagcatggcgtgtgttgggttcttcttggtccagagggccggt
ccacacgtgggtggtcaggacaagcccttcctgtctgcctggcccagcgctgtggtgcct
cgaggaggacacgtgactcttcggtgtcactatcgtcataggtttaacaatttcatgcta
tacaaagaagacagaatccacgttcccatcttccatggcagattattccaggagagcttc
aacatgagccctgtgaccacagcacatgcagggaactacacatgtcggggttcacaccca
cactcccccactgggtggtcggcacccagcaaccccgtggtgatcatggtcacaggaaac
cacagaaaaccttccctcctggcccacccaggtcccctggtgaaatcaggagagagagtc
atcctgcaatgttggtcagatatcatgtttgagcacttctttctgcacaaagaggggatc
tctaaggacccctcacgcctcgttggacagatccatgatggggtctccaaggccaatttc
tccatcggtcccatgatgcttgcccttgcagggacctacagatgctacggttctgttact
cacaccccctatcagttgtcagctcccagtgatcccctggacatcgtggtcacaggtcca
tatgagaaaccttctctctcagcccagccgggccccaaggttcaggcaggagagagcgtg
accttgtcctgcagctcccggagctcctatgacatgtaccatctatccagggagggggga
gcccatgaacgtaggctccctgcagtgcgcaaggtcaacagaacattccaggcagatttc
cctctgggccctgccacccacggagggacctacagatgcttcggctctttccgtcactct
ccctacgagtggtcagacccgagtgacccactgcttgtttctgtcacaggaaacccttca
agtagttggccttcacccacagaaccaagctccaaatctggtaaccccagacacctgcac
attctgattgggacctcagtggtcatcatcctcttcatcctcctcctcttctttctcctt
catctctggtgctccaacaaaaaaaatgctgctgtaatggaccaagagcctgcagggaac
agaacagccaacagcgaggactctgatgaacaagaccctgaggaggtgacatacgcacag
ttggatcactgcgttttcacacagagaaaaatcactcgcccttctcagaggcccaagaca
ccccctacagataccatcttgtacacggaacttccaaatgctaagcccagatccaaagtt
gtctcctgcccatga

KEGG   Homo sapiens (human): 3812
Entry
3812              CDS       T01001                                 
Symbol
KIR3DL2, 3DL2, CD158K, KIR-3DL2, NKAT-4, NKAT4, NKAT4B, p140
Name
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3812 (KIR3DL2)
   04612 Antigen processing and presentation
    3812 (KIR3DL2)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3812 (KIR3DL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3812 (KIR3DL2)
CD molecules [BR:hsa04090]
 Proteins
  3812 (KIR3DL2)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 MAP17
Other DBs
NCBI-GeneID: 3812
NCBI-ProteinID: NP_006728
OMIM: 604947
HGNC: 6339
Ensembl: ENSG00000240403
Pharos: P43630(Tbio)
UniProt: P43630 Q8NHK6 A0A0U1WNF3
LinkDB
Position
19:54850443..54867207
AA seq 455 aa
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFML
YKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGN
HRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANF
SIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRAL
PCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLL
YRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKT
PLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtcgctcacggtcgtcagcatggcgtgcgttgggttcttcttgctgcagggggcctgg
ccactcatgggtggtcaggacaaacccttcctgtctgcccggcccagcactgtggtgcct
cgaggaggacacgtggctcttcagtgtcactatcgtcgtgggtttaacaatttcatgctg
tacaaagaagacagaagccacgttcccatcttccacggcagaatattccaggagagcttc
atcatgggccctgtgaccccagcacatgcagggacctacagatgtcggggttcacgccca
cactccctcactgggtggtcggcacccagcaaccccctggtgatcatggtcacaggaaac
cacagaaaaccttccctcctggcccacccagggcccctgctgaaatcaggagagacagtc
atcctgcaatgttggtcagatgtcatgtttgagcacttctttctgcacagagaggggatc
tctgaggacccctcacgcctcgttggacagatccatgatggggtctccaaggccaacttc
tccatcggtcccttgatgcctgtccttgcaggaacctacagatgttatggttctgttcct
cactccccctatcagttgtcagctcccagtgaccccctggacatcgtgatcacaggtcta
tatgagaaaccttctctctcagcccagccgggccccacggttcaggcaggagagaacgtg
accttgtcctgtagctcctggagctcctatgacatctaccatctgtccagggaaggggag
gcccatgaacgtaggctccgtgcagtgcccaaggtcaacagaacattccaggcagacttt
cctctgggccctgccacccacggagggacctacagatgcttcggctctttccgtgccctg
ccctgcgtgtggtcaaactcaagtgacccactgcttgtttctgtcacaggaaacccttca
agtagttggccttcacccacagaaccaagctccaaatctggtatctgcagacacctgcat
gttctgattgggacctcagtggtcatcttcctcttcatcctcctcctcttctttctcctt
tatcgctggtgctccaacaaaaagaatgctgctgtaatggaccaagagcctgcgggggac
agaacagtgaataggcaggactctgatgaacaagaccctcaggaggtgacgtacgcacag
ttggatcactgcgttttcatacagagaaaaatcagtcgcccttctcagaggcccaagaca
cccctaacagataccagcgtgtacacggaacttccaaatgctgagcccagatccaaagtt
gtctcctgcccacgagcaccacagtcaggtcttgagggggttttctag

DBGET integrated database retrieval system