KEGG   Homo sapiens (human): 122769
Entry
122769            CDS       T01001                                 
Symbol
LRR1, 4-1BBLRR, LRR-1, PPIL5
Name
(RefSeq) leucine rich repeat protein 1
  KO
K10348  LRR-repeat protein 1
Organism
hsa  Homo sapiens (human)
Network
nt06509  DNA replication
  Element
N01473  DNA replication termination
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    122769 (LRR1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul2 complex
    Target recognizing subunit
     122769 (LRR1)
SSDB
Motif
Pfam: LRR_4 LRR_8 LRR_6
Other DBs
NCBI-GeneID: 122769
NCBI-ProteinID: NP_689542
OMIM: 609193
HGNC: 19742
Ensembl: ENSG00000165501
Pharos: Q96L50(Tbio)
UniProt: Q96L50 Q6AWA7
Structure
LinkDB
Position
14:49598940..49614672
AA seq 414 aa
MKLHCEVEVISRHLPALGLRNRGKGVRAVLSLCQQTSRSQPPVRAFLLISTLKDKRGTRY
ELRENIEQFFTKFVDEGKATVRLKEPPVDICLSKAISSSLKGFLSAMRLAHRGCNVDTPV
STLTPVKTSEFENFKTKMVITSKKDYPLSKNFPYSLEHLQTSYCGLVRVDMRMLCLKSLR
KLDLSHNHIKKLPATIGDLIHLQELNLNDNHLESFSVALCHSTLQKSLRSLDLSKNKIKA
LPVQFCQLQELKNLKLDDNELIQFPCKIGQLINLRFLSAARNKLPFLPSEFRNLSLEYLD
LFGNTFEQPKVLPVIKLQAPLTLLESSARTILHNRIPYGSHIIPFHLCQDLDTAKICVCG
RFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDMLK
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgaagctacactgtgaggtggaggtgatcagccggcacttgcccgccttggggcttagg
aaccggggcaagggcgtccgagccgtgttgagcctctgtcagcagacttccaggagtcag
ccgccggtccgagccttcctgctcatctccaccctgaaggacaagcgcgggacccgctat
gagctaagggagaacattgagcaattcttcaccaaatttgtagatgaggggaaagccact
gttcggttaaaggagcctcctgtggatatctgtctaagtaaggccatttccagcagttta
aaaggtttcctttcagctatgagactggctcatagaggctgtaatgttgatacaccagtt
tcaacgctcacaccagtgaagacttcagaatttgaaaactttaaaactaaaatggttatc
acatccaaaaaagactatcctctaagtaagaattttccatattccttggaacatcttcag
acttcttactgtgggcttgtccgagttgatatgcgtatgctttgcttaaaaagccttagg
aaattagacttgagtcacaaccatataaaaaagcttccagctacaattggagacctcata
caccttcaagaacttaacctgaatgacaatcacttggagtcatttagtgtagccttgtgt
cattctacactccagaagtcacttcggagtttggacctcagcaagaacaaaatcaaggca
ctccctgtgcagttttgccagctccaggaacttaagaatttaaaacttgacgataatgaa
ttgattcaatttccttgcaagataggacaactaataaaccttcgctttttgtcagcagct
cgaaataagcttccatttttgcctagtgaatttagaaatttatcccttgaatacttggat
ctttttggaaatacttttgaacaaccaaaagtccttccagtaataaagctgcaagcacca
ttaactttattggaatcttctgcacgaaccatattacataataggattccatatggctct
catatcattccattccatctctgccaagatttggataccgcaaaaatttgtgtttgtgga
agattctgtctgaactctttcattcaaggaactactaccatgaatctgcattctgttgcc
cacactgtggtcttagtagataatttgggtggtactgaagcacctattatctcttatttc
tgttctctaggctgttatgttaattcctctgatatgttaaagtaa

DBGET integrated database retrieval system