KEGG   Homo sapiens (human): 126961
Entry
126961            CDS       T01001                                 
Symbol
H3C14, H3, H3.2, H3/M, H3C13, H3C15, H3F2, H3FM, H3FN, HIST2H3C
Name
(RefSeq) H3 clustered histone 14
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    126961 (H3C14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    126961 (H3C14)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    126961 (H3C14)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    126961 (H3C14)
  09165 Substance dependence
   05034 Alcoholism
    126961 (H3C14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    126961 (H3C14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    126961 (H3C14)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    126961 (H3C14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   126961 (H3C14)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 126961
NCBI-ProteinID: NP_066403
OMIM: 142780
HGNC: 20503
Ensembl: ENSG00000203811
UniProt: Q71DI3
Structure
LinkDB
Position
1:complement(149840687..149841208)
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgtactaagcagactgctcgcaagtcgaccggcggcaaggccccgaggaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtagccctgcgggagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatt
atgcccaaggacatccagctggcccgccgcatccgtggagagcgggcttaa

KEGG   Homo sapiens (human): 3020
Entry
3020              CDS       T01001                                 
Symbol
H3-3A, BRYLIB1, H3-3B, H3.3A, H3F3, H3F3A
Name
(RefSeq) H3.3 histone A
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Disease
H01470  Giant cell tumor of bone
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3020 (H3-3A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3020 (H3-3A)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    3020 (H3-3A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3020 (H3-3A)
  09165 Substance dependence
   05034 Alcoholism
    3020 (H3-3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3020 (H3-3A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3020 (H3-3A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3020 (H3-3A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3020 (H3-3A)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3020
NCBI-ProteinID: NP_002098
OMIM: 601128
HGNC: 4764
Ensembl: ENSG00000163041
UniProt: P84243 B2R4P9
Structure
LinkDB
Position
1:226061831..226072019
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa
ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat
cgttacaggcctggtactgtggcgctccgtgaaattagacgttatcagaagtccactgaa
cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa
acagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagtgaggcctat
ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt
atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

KEGG   Homo sapiens (human): 3021
Entry
3021              CDS       T01001                                 
Symbol
H3-3B, BRYLIB2, H3-3A, H3.3B, H3F3B
Name
(RefSeq) H3.3 histone B
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3021 (H3-3B)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3021 (H3-3B)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    3021 (H3-3B)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3021 (H3-3B)
  09165 Substance dependence
   05034 Alcoholism
    3021 (H3-3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3021 (H3-3B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3021 (H3-3B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3021 (H3-3B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3021 (H3-3B)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3021
NCBI-ProteinID: NP_005315
OMIM: 601058
HGNC: 4765
Ensembl: ENSG00000132475
Pharos: P84243(Tbio)
UniProt: P84243 B2R4P9
Structure
LinkDB
Position
17:complement(75776434..75779779)
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgctcgtaagtccaccggtgggaaagccccccgcaaacag
ctggccacgaaagccgccaggaaaagcgctccctctaccggcggggtgaagaagcctcat
cgctacaggcccgggaccgtggcgcttcgagagattcgtcgttatcagaagtcgaccgag
ctgctcatccggaagctgcccttccagaggttggtgagggagatcgcgcaggatttcaaa
accgacctgaggtttcagagcgcagccatcggtgcgctgcaggaggctagcgaagcgtac
ctggtgggtctgttcgaagataccaacctgtgtgccatccacgctaagagagtcaccatc
atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

KEGG   Homo sapiens (human): 333932
Entry
333932            CDS       T01001                                 
Symbol
H3C15, H3/n, H3/o, H3C13, H3C14, HIST2H3A
Name
(RefSeq) H3 clustered histone 15
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    333932 (H3C15)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    333932 (H3C15)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    333932 (H3C15)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    333932 (H3C15)
  09165 Substance dependence
   05034 Alcoholism
    333932 (H3C15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    333932 (H3C15)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    333932 (H3C15)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    333932 (H3C15)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   333932 (H3C15)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 333932
NCBI-ProteinID: NP_001005464
HGNC: 20505
Ensembl: ENSG00000203852
UniProt: Q71DI3
Structure
LinkDB
Position
1:149852608..149853125
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgtactaagcagactgctcgcaagtcgaccggcggcaaggccccgaggaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtagccctgcgggagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccacgccaagcgcgtgaccatt
atgcccaaggacatccagctggcccgccgcatccgtggagagcgggcttaa

KEGG   Homo sapiens (human): 440093
Entry
440093            CDS       T01001                                 
Symbol
H3-5, H3.3C, H3.5, H3F3C
Name
(RefSeq) H3.5 histone
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    440093 (H3-5)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    440093 (H3-5)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    440093 (H3-5)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    440093 (H3-5)
  09165 Substance dependence
   05034 Alcoholism
    440093 (H3-5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    440093 (H3-5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    440093 (H3-5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    440093 (H3-5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   440093 (H3-5)
SSDB
Motif
Pfam: Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 440093
NCBI-ProteinID: NP_001013721
OMIM: 616134
HGNC: 33164
Ensembl: ENSG00000188375
Pharos: Q6NXT2(Tbio)
UniProt: Q6NXT2
Structure
LinkDB
Position
12:complement(31791185..31792298)
AA seq 135 aa
MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIM
PKDIQLARRIRGERA
NT seq 408 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgctcgtaaatccaccggtgggaaagccccccgcaaacag
ctggccacgaaagctgccaggaaaagcaccccctctacctgcggggtgaagcctcatcgc
tacaggcctgggaccgtggcgcttcgagagattcgtcgttatcagaagtcgaccgagctg
ctcatccggaagctgcccttccagaggttggtgagggagatcgcgcaggatttcaacact
gacctgaggtttcagagcgcagccgtcggtgcgctgcaggaggctagcgaagcgtacctg
gtgggtctgttggaagatactaacctgtgtgccatccacgctaagagagtcaccatcatg
cccaaagacatccagttggctcgccggatacggggagagagagcttaa

KEGG   Homo sapiens (human): 653604
Entry
653604            CDS       T01001                                 
Symbol
H3C13, H3C14, H3C15, HIST2H3D
Name
(RefSeq) H3 clustered histone 13
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    653604 (H3C13)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    653604 (H3C13)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    653604 (H3C13)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    653604 (H3C13)
  09165 Substance dependence
   05034 Alcoholism
    653604 (H3C13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    653604 (H3C13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    653604 (H3C13)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    653604 (H3C13)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   653604 (H3C13)
SSDB
Motif
Pfam: Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 653604
NCBI-ProteinID: NP_001116847
HGNC: 25311
Ensembl: ENSG00000183598
Pharos: Q71DI3(Tdark)
UniProt: Q71DI3
Structure
LinkDB
Position
1:complement(149813225..149813693)
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgtactaagcagactgcccgcaagtcgaccggcggcaaggccccgaggaagcag
ctggctaccaaagcggcccgcaagagcgcgccggccacgggcggggtgaagaagccgcac
cgctaccggcccggcaccgtggctctgcgggagatccggcgctaccagaagtctacggag
ctgctgatccgcaagctgcccttccagcggctggtacgcgagatcgcgcaggactttaag
acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggccagcgaggcctac
ctggtggggctgttcgaagacacgaacctgtgcgccatccatgccaagcgcgtgaccatc
atgcccaaggacatccagttggcccgccgcatccgcggggagcgggcctaa

KEGG   Homo sapiens (human): 8290
Entry
8290              CDS       T01001                                 
Symbol
H3-4, H3.4, H3/g, H3C16, H3FT, H3t, HIST3H3
Name
(RefSeq) H3.4 histone, cluster member
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8290 (H3-4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8290 (H3-4)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8290 (H3-4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8290 (H3-4)
  09165 Substance dependence
   05034 Alcoholism
    8290 (H3-4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8290 (H3-4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8290 (H3-4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8290 (H3-4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8290 (H3-4)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF PAF CENP-T_C CENP-S
Other DBs
NCBI-GeneID: 8290
NCBI-ProteinID: NP_003484
OMIM: 602820
HGNC: 4778
Ensembl: ENSG00000168148
Pharos: Q16695(Tbio)
UniProt: Q16695
Structure
LinkDB
Position
1:complement(228424845..228425360)
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgcgcgcaagtcaacgggtggcaaggcgccgcgcaagcag
ctggccaccaaggtggctcgcaagagcgcacctgccactggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggcgcttcgcgagatccgccgctaccagaagtccactgag
ctgctaatccgcaagttgcccttccagcggctgatgcgcgagatcgctcaggactttaag
accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgagtcttac
ctggtggggctgtttgaggacaccaacctgtgtgtcatccatgccaaacgggtcaccatc
atgcctaaggacatccagctggcacgccgtatccgcggggagcgggcctag

KEGG   Homo sapiens (human): 8350
Entry
8350              CDS       T01001                                 
Symbol
H3C1, H3/A, H3C10, H3C11, H3C12, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, HIST1H3A
Name
(RefSeq) H3 clustered histone 1
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8350 (H3C1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8350 (H3C1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8350 (H3C1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8350 (H3C1)
  09165 Substance dependence
   05034 Alcoholism
    8350 (H3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8350 (H3C1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8350 (H3C1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8350 (H3C1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8350 (H3C1)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 8350
NCBI-ProteinID: NP_003520
OMIM: 602810
HGNC: 4766
Ensembl: ENSG00000275714
UniProt: P68431
Structure
LinkDB
Position
6:26020451..26020958
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgcactaagcaaactgctcggaagtctactggtggcaaggcgccacgcaaacag
ttggccactaaggcagcccgcaaaagcgctccggccaccggcggcgtgaaaaagccccac
cgctaccggccgggcaccgtggctctgcgcgagatccgccgttatcagaagtccactgaa
ctgcttattcgtaaactacctttccagcgcctggtgcgcgagattgcgcaggactttaaa
acagacctgcgtttccagagctccgctgtgatggctctgcaggaggcgtgcgaggcctac
ttggtagggctatttgaggacactaacctgtgcgccatccacgccaagcgcgtcactatc
atgcccaaggacatccagctcgcccgccgcatccgcggagagagggcgtga

KEGG   Homo sapiens (human): 8351
Entry
8351              CDS       T01001                                 
Symbol
H3C4, H3/b, H3C1, H3C10, H3C11, H3C12, H3C2, H3C3, H3C6, H3C7, H3C8, H3FB, HIST1H3D
Name
(RefSeq) H3 clustered histone 4
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8351 (H3C4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8351 (H3C4)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8351 (H3C4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8351 (H3C4)
  09165 Substance dependence
   05034 Alcoholism
    8351 (H3C4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8351 (H3C4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8351 (H3C4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8351 (H3C4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8351 (H3C4)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 8351
NCBI-ProteinID: NP_003521
OMIM: 602811
HGNC: 4767
Ensembl: ENSG00000197409
UniProt: P68431
Structure
LinkDB
Position
6:complement(26196784..26199293)
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtaccaagcagactgctcgcaagtccacgggtgggaaagcgccacgcaagcag
ctggccaccaaggctgctcgaaagagcgctccagccaccggcggcgtgaagaagccccac
cgttaccggcccggcacggtggctctgcgcgagatccgccgctaccagaagtcgaccgag
ctgctgattcgcaaactgccattccagcgtctagtccgtgagatcgcgcaggacttcaag
actgatctgcgttttcagagctcggcggtgatggcgctgcaggaggcctgcgaggcctac
ctggtggggctgtttgaggacaccaacctatgcgccattcacgccaagcgagtgactatc
atgcccaaggacatccagcttgctcgccgcattcgtggggagagggcgtaa

KEGG   Homo sapiens (human): 8352
Entry
8352              CDS       T01001                                 
Symbol
H3C3, H3.1, H3/c, H3C1, H3C10, H3C11, H3C12, H3C2, H3C4, H3C6, H3C7, H3C8, H3FC, HIST1H3C
Name
(RefSeq) H3 clustered histone 3
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8352 (H3C3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8352 (H3C3)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8352 (H3C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8352 (H3C3)
  09165 Substance dependence
   05034 Alcoholism
    8352 (H3C3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8352 (H3C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8352 (H3C3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8352 (H3C3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8352 (H3C3)
SSDB
Motif
Pfam: Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF
Other DBs
NCBI-GeneID: 8352
NCBI-ProteinID: NP_003522
OMIM: 602812
HGNC: 4768
Ensembl: ENSG00000287080
UniProt: P68431
Structure
LinkDB
Position
6:26045384..26045869
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctcgtacgaagcaaacagctcgcaagtctaccggcggcaaagctccgcgcaagcag
cttgctactaaagcagcccgtaagagcgctccggccaccggtggcgtgaagaaacctcat
cgctaccgcccgggcaccgtggccttgcgcgaaatccgtcgctaccagaagtccaccgag
ctgctgatccggaagctgccgttccagcgcctggtgcgagaaatcgcccaggacttcaaa
accgacctgcgtttccagagctctgcggtgatggcgctgcaggaggcttgtgaggcctac
ctggtgggactcttcgaagacaccaatctgtgcgctattcacgctaaacgcgtcaccatc
atgcccaaagatatccagctggcacgtcgcatccgtggggaaagggcataa

DBGET integrated database retrieval system