KEGG   Homo sapiens (human): 133396
Entry
133396            CDS       T01001                                 
Symbol
IL31RA, CRL, CRL3, GLM-R, GLMR, GPL, IL-31RA, PLCA2, PRO21384, hGLM-R, zcytoR17
Name
(RefSeq) interleukin 31 receptor A
  KO
K22630  interleukin 31 receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
Disease
H01217  Primary localized cutaneous amyloidosis
Drug target
Nemolizumab: D11080<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    133396 (IL31RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    133396 (IL31RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    133396 (IL31RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   133396 (IL31RA)
SSDB
Motif
Pfam: fn3 IL6Ra-bind IL2RB_N1 EpoR_lig-bind IL4Ra_N
Other DBs
NCBI-GeneID: 133396
NCBI-ProteinID: NP_001229565
OMIM: 609510
HGNC: 18969
Ensembl: ENSG00000164509
Pharos: Q8NI17(Tbio)
UniProt: Q8NI17 B4DNJ2
LinkDB
Position
5:55839789..55922850
AA seq 745 aa
MKLSPQPSCVNLGMMWTWALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKE
TSYTQYTVKRTYAFGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVI
KSHMTYWRLENIAKTEPPKIFRVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNS
TSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAP
CGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQ
QLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQS
SALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVG
EPYSIQAYAKEGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKG
FSKTVNSSILQYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLI
GGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVN
TEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPD
CPLGKSFEELPVSPEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLCEEGAPNP
YLKNSVTAREFLVSEKLPEHTKGEV
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgaagctctctccccagccttcatgtgttaacctggggatgatgtggacctgggcactg
tggatgctcccctcactctgcaaattcagcctggcagctctgccagctaagcctgagaac
atttcctgtgtctactactataggaaaaatttaacctgcacttggagtccaggaaaggaa
accagttatacccagtacacagttaagagaacttacgcttttggagaaaaacatgataat
tgtacaaccaatagttctacaagtgaaaatcgtgcttcgtgctcttttttccttccaaga
ataacgatcccagataattataccattgaggtggaagctgaaaatggagatggtgtaatt
aaatctcatatgacatactggagattagagaacatagcgaaaactgaaccacctaagatt
ttccgtgtgaaaccagttttgggcatcaaacgaatgattcaaattgaatggataaagcct
gagttggcgcctgtttcatctgatttaaaatacacacttcgattcaggacagtcaacagt
accagctggatggaagtcaacttcgctaagaaccgtaaggataaaaaccaaacgtacaac
ctcacggggctgcagccttttacagaatatgtcatagctctgcgatgtgcggtcaaggag
tcaaagttctggagtgactggagccaagaaaaaatgggaatgactgaggaagaagctcca
tgtggcctggaactgtggagagtcctgaaaccagctgaggcggatggaagaaggccagtg
cggttgttatggaagaaggcaagaggagccccagtcctagagaaaacacttggctacaac
atatggtactatccagaaagcaacactaacctcacagaaacaatgaacactactaaccag
cagcttgaactgcatctgggaggcgagagcttttgggtgtctatgatttcttataattct
cttgggaagtctccagtggccaccctgaggattccagctattcaagaaaaatcatttcag
tgcattgaggtcatgcaggcctgcgttgctgaggaccagctagtggtgaagtggcaaagc
tctgctctagacgtgaacacttggatgattgaatggtttccggatgtggactcagagccc
accaccctttcctgggaatctgtgtctcaggccacgaactggacgatccagcaagataaa
ttaaaacctttctggtgctataacatctctgtgtatccaatgttgcatgacaaagttggc
gagccatattccatccaggcttatgccaaagaaggcgttccatcagaaggtcctgagacc
aaggtggagaacattggcgtgaagacggtcacgatcacatggaaagagattcccaagagt
gagagaaagggtatcatctgcaactacaccatcttttaccaagctgaaggtggaaaagga
ttctccaagacagtcaattccagcatcttgcagtacggcctggagtccctgaaacgaaag
acctcttacattgttcaggtcatggccagcaccagtgctgggggaaccaacgggaccagc
ataaatttcaagacattgtcattcagtgtctttgagattatcctcataacttctctgatt
ggtggaggccttcttattctcattatcctgacagtggcatatggtctcaaaaaacccaac
aaattgactcatctgtgttggcccaccgttcccaaccctgctgaaagtagtatagccaca
tggcatggagatgatttcaaggataagctaaacctgaaggagtctgatgactctgtgaac
acagaagacaggatcttaaaaccatgttccacccccagtgacaagttggtgattgacaag
ttggtggtgaactttgggaatgttctgcaagaaattttcacagatgaagccagaacgggt
caggaaaacaatttaggaggggaaaagaatgggtatgtgacctgccccttcaggcctgat
tgtcccctggggaaaagttttgaggagctcccagtttcacctgagattccgcccagaaaa
tcccaatacctacgttcgaggatgccagaggggacccgcccagaagccaaagagcagctt
ctcttttctggtcaaagtttagtaccagatcatctgtgtgaggaaggagccccaaatcca
tatttgaaaaattcagtgacagccagggaatttcttgtgtctgaaaaacttccagagcac
accaagggagaagtctaa

DBGET integrated database retrieval system