KEGG   Homo sapiens (human): 1489
Entry
1489              CDS       T01001                                 
Symbol
CTF1, CT-1, CT1
Name
(RefSeq) cardiotrophin 1
  KO
K05422  cardiotrophin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1489 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1489 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1489 (CTF1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1489 (CTF1)
SSDB
Motif
Pfam: LIF_OSM pPIWI_RE_X NolB PRF
Other DBs
NCBI-GeneID: 1489
NCBI-ProteinID: NP_001321
OMIM: 600435
HGNC: 2499
Ensembl: ENSG00000150281
Pharos: Q16619(Tbio)
UniProt: Q16619
LinkDB
Position
16:30895846..30903560
AA seq 201 aa
MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGL
YREWLSRTEGDLGQLLPGGSA
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaagacccccagactgattcctcagtctcacttctt
ccccacttggaggccaagatccgtcagacacacagccttgcgcacctcctcaccaaatac
gctgagcagctgctccaggaatatgtgcagctccagggagaccccttcgggctgcccagc
ttctcgccgccgcggctgccggtggccggcctgagcgccccggctccgagccacgcgggg
ctgccagtgcacgagcggctgcggctggacgcggcggcgctggccgcgctgcccccgctg
ctggacgcagtgtgtcgccgccaggccgagctgaacccgcgcgcgccgcgcctgctgcgc
cgcctggaggacgcggcgcgccaggcccgggccctgggcgccgccgtggaggccttgctg
gccgcgctgggcgccgccaaccgcgggccccgggccgagccccccgccgccaccgcctca
gccgcctccgccaccggggtcttccccgccaaggtgctggggctccgcgtttgcggcctc
taccgcgagtggctgagccgcaccgagggcgacctgggccagctgctgcccgggggctcg
gcctga

DBGET integrated database retrieval system